Identifiers and Description

Gene Model Identifier

TTHERM_00191450

Standard Name

TTS1

Aliases

PreTt08796 | 15.m00507 | 3697.m00218

Description

Glycosyl hydrolase family 20, catalytic domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF06773 ) Bim protein N-terminus
  • ( PF02838 ) Glycosyl hydrolase family 20, domain
  • ( PF00728 ) Glycosyl hydrolase family 20, catalytic

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 78.6%

TetraMine Data

TTHERM_00191450

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13349.19.997093137033517e-262glycosyl hydrolase family 20,
catalytic domain-containing pr
otein (553 aa)
OxytrichaContig14777.0.g764.999878681532552e-93Glycosyl hydrolase family 20,
catalytic domain
DictyBaseDDB_G02870332.0007889996237956e-71nagA on chromosome: 4 position
5251113 to 5252898
WormBaseWBGene000205091.0004249259458435e-52locus:hex-1 Beta-hexosaminid
ase A status:Confirmed Uni
Prot:Q22492 protein_id:CCD68
941.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000088
  2. Ref:SUPR000089

Sequences

>TTHERM_00191450(coding)
ATGAATCTCAATTTCAAAAAGTATTTGGTTATCTGTTTAGCAATCGCTTTTGTGGCTTCA
TAAGTTACACCAGGAGTTGATCCTATTGCTGCTAAAGTTATTCCTAAACCAAAAACTTAT
ACTTTTGGTACTTAAACGCTTAAAATTTCCAACCCTTGCAACATTGTTTACAGACCTCAA
GTTAATTAAGCTGGGTACGTCCCTGATCATGTGTTCTAGATGATAAATCTATATTCAAAT
TTGACATTCTAATCAACTTTCAATTCAACAAATTGCAATTTTGTTAGTAGCAACATTAAA
TAAATGTTGAACGCTTTTGACCCTTCTAATATCATTTTTGATATCTTCATAAGCGATATG
AATTTGACTATTGCAGATACTATCTAAGATGAATCTTACTCTCTTAATTTATTAAATTCA
TCATATTGGTAATTAAATGCAACAAAGTATGTAGGATTTGTTAGAGGCCTTGAAACATTT
TCATAGCTCTTTGTTTAAGATGAAGTCTCTTCTGCTTGGAGCATCCCAAGTCTCCCTATT
TCTATTTAGGATTCTCCCGACTACCCTTACAGAGGCCTTATGATAGATACCGCAAGACAC
TTTTTGAGCGTTAATACTATACTAAAGACAATTGATTCTATGCAATATAATAAACTAAAT
GTATTGCATTGGCATATTACTGATGACGATTCTTTTCCATATCCACTTTAATCATTTCCA
AATGTGACTCAATATGGTGCTTTTTCTTTTAGAAAATAGTACTCTTTAACAGATATTTAA
TACATAGTTAGATATGCTCTTCTTAGAGGAATATAAGTTGTTCCAGAAATAGATTCCCCA
GGCCATGCTTTTTCTTGGGGTAAAAGTCCTCAATTCTCTAATGTAGCATTATAGTGTGAT
AAATTTAATGGTCAATTAGATCCCTCTCAAAAAGAAACATGGTAGCTTGTTAATGGAGTA
CTTACTGATCTAGAAAATTAATTCTACACTTCTAAGTATATTCATTTAGGTGGTGATGAA
GTAGATGAAGGATGCTGGGATTAATCAAGTGACCTAAAGTAATATATGAAAGATAATAAT
ATTTAAAATTATGATGATCTCTAAACCTTTTATAGATAAACTCAAAAAAATCTTTACAGG
AAAATAAATCCCACTAAACCTGCTATTTATTGGTCAGACAAAGATAATTACAAATTAGGA
CTTTAGCCTGACGATATTGTTTAATGGTGGGGAGAAATGAGTAATTTTAAGTTAATATCT
AATATAACTAACAGAATAATCCTTTCATCTTAGGATTATGCTTATTTAGACGTTGGATTT
GGTGATGAGTTAGGAGGAGATTACAATTAAATGTATAACTGGAAAGCAATGTATGCATTT
AATCCTTAAATATCAGGAATAAAAGGAAAGATTATTGGTGCGGAAGTTTGCTTGTGGTCA
GAGCTAAGTGATGATGATGTATATCTAACAAGGATATGGACAAGAACAAGCGCATTTTCT
GAGAGACTTTGGAATTTGAACGCTAGTAATGGATAAAAACTAAAATATAGAGCATTAGCT
AGTAGAATGGTTTTCATGAAAAACAGATTAAATGCAAGAGGAGTAAAAGCAACTCCAGTA
ACTCTTGAAATCTGTGAAAGAGATCTTTCTTTATGCTTTAGTAATTGA


>TTHERM_00191450(protein)
MNLNFKKYLVICLAIAFVASQVTPGVDPIAAKVIPKPKTYTFGTQTLKISNPCNIVYRPQ
VNQAGYVPDHVFQMINLYSNLTFQSTFNSTNCNFVSSNIKQMLNAFDPSNIIFDIFISDM
NLTIADTIQDESYSLNLLNSSYWQLNATKYVGFVRGLETFSQLFVQDEVSSAWSIPSLPI
SIQDSPDYPYRGLMIDTARHFLSVNTILKTIDSMQYNKLNVLHWHITDDDSFPYPLQSFP
NVTQYGAFSFRKQYSLTDIQYIVRYALLRGIQVVPEIDSPGHAFSWGKSPQFSNVALQCD
KFNGQLDPSQKETWQLVNGVLTDLENQFYTSKYIHLGGDEVDEGCWDQSSDLKQYMKDNN
IQNYDDLQTFYRQTQKNLYRKINPTKPAIYWSDKDNYKLGLQPDDIVQWWGEMSNFKLIS
NITNRIILSSQDYAYLDVGFGDELGGDYNQMYNWKAMYAFNPQISGIKGKIIGAEVCLWS
ELSDDDVYLTRIWTRTSAFSERLWNLNASNGQKLKYRALASRMVFMKNRLNARGVKATPV
TLEICERDLSLCFSN


>TTHERM_00191450(gene)
ATGAATCTCAATTTCAAAAAGTATTTGGTTATCTGTTTAGCAATCGCTTTTGTGGCTTCA
TAAGTTACACCAGGAGTTGATCCTATTGCTGCTAAAGTTATTCCTAAACCAAAAACTTAT
ACTTTTGGTACTTAAACGCTTAAAATTTCCAACCCTTGCAACATTGTTTACAGACCTCAA
GTTAATTAAGCTGGGTACGTCCCTGATCATGTGTTCTAGATGATAAATCTATATTCAAAT
TTGACATTCTAATCAACTTTCAATTCAACAAATTGCAATTTTGTTAGTAGCAACATTAAA
TAAATGTTGAACGCTTTTGACCCTTCTAATATCATTTTTGATATCTTCATAAGCGATATG
AATTTGACTATTGCAGATACTATCTAAGATGAATCTTACTCTCTTAATTTATTAAATTCA
TCATATTGGTAATTAAATGCAACAAAGTATGTAGGATTTGTTAGAGGCCTTGAAACATTT
TCATAGCTCTTTGTTTAAGATGAAGTCTCTTCTGCTTGGAGCATCCCAAGTCTCCCTATT
TCTATTTAGGATTCTCCCGACTACCCTTACAGAGGCCTTATGATAGATACCGCAAGACAC
TTTTTGAGCGTTAATACTATACTAAAGACAATTGATTCTATGCAATATAATAAACTAAAT
GTATTGCATTGGCATATTACTGATGACGATTCTTTTCCATATCCACTTTAATCATTTCCA
AATGTGACTCAATATGGTGCTTTTTCTTTTAGAAAATAGTACTCTTTAACAGATATTTAA
TACATAGTTAGATATGCTCTTCTTAGAGGAATATAAGTTGTTCCAGAAATAGATTCCCCA
GGCCATGCTTTTTCTTGGGGTAAAAGTCCTCAATTCTCTAATGTAGCATTATAGTGTGAT
AAATTTAATGGTCAATTAGATCCCTCTCAAAAAGAAACATGGTAGCTTGTTAATGGAGTA
CTTACTGATCTAGAAAATTAATTCTACACTTCTAAGTATATTCATTTAGGTGGTGATGAA
GTAGATGAAGGATGCTGGGATTAATCAAGTGACCTAAAGTAATATATGAAAGATAATAAT
ATTTAAAATTATGATGATCTCTAAACCTTTTATAGATAAACTCAAAAAAATCTTTACAGG
AAAATAAATCCCACTAAACCTGCTATTTATTGGTCAGACAAAGATAATTACAAATTAGGA
CTTTAGCCTGACGATATTGTTTAATGGTGGGGAGAAATGAGTAATTTTAAGTTAATATCT
AATATAACTAACAGAATAATCCTTTCATCTTAGGATTATGCTTATTTAGACGTTGGATTT
GGTGATGAGTTAGGAGGAGATTACAATTAAATGTATAACTGGAAAGCAATGTATGCATTT
AATCCTTAAATATCAGGAATAAAAGGAAAGATTATTGGTGCGGAAGTTTGCTTGTGGTCA
GAGCTAAGTGATGATGATGTATATCTAACAAGGATATGGACAAGAACAAGCGCATTTTCT
GAGAGACTTTGGAATTTGAACGCTAGTAATGGATAAAAACTAAAATATAGAGCATTAGCT
AGTAGAATGGTTTTCATGAAAAACAGATTAAATGCAAGAGGAGTAAAAGCAACTCCAGTA
ACTCTTGAAATCTGTGAAAGAGATCTTTCTTTATGCTTTAGTAATTGA