Identifiers and Description

Gene Model Identifier

TTHERM_00985160

Standard Name

TTP95 (p95 )

Aliases

PreTt23286 | 184.m00061 | p95

Description

Protein that complexes with p80, initially isolated by telomerase association, but deletion results in telomere lengthening without affecting telomerase stability or activity

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07599 ) Protein of unknown function (DUF1563)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00985160

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13003.19.997093137033517e-262hypothetical protein (878 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11592988: Mason DX, Autexier C, Greider CW (2001) Tetrahymena proteins p80 and p95 are not core telomerase components. Proceedings of the National Academy of Sciences of the United States of America 98(22):12368-73
  2. Ref:11090621: Miller MC, Collins K (2000) The Tetrahymena p80/p95 complex is required for proper telomere length maintenance and micronuclear genome stability. Molecular cell 6(4):827-37
  3. Ref:9499406: Gandhi L, Collins K (1998) Interaction of recombinant Tetrahymena telomerase proteins p80 and p95 with telomerase RNA and telomeric DNA substrates. Genes & development 12(5):721-33
  4. Ref:9671704: Collins K, Gandhi L (1998) The reverse transcriptase component of the Tetrahymena telomerase ribonucleoprotein complex. Proceedings of the National Academy of Sciences of the United States of America 95(15):8485-90
  5. Ref:7774009: Collins K, Kobayashi R, Greider CW (1995) Purification of Tetrahymena telomerase and cloning of genes encoding the two protein components of the enzyme. Cell 81(5):677-86

Sequences

>TTHERM_00985160(coding)
ATGTCAAGGCGTAACTAAAAAAAGCCATAGGCTCCTATAGGCAATGAAACAAATCTTGAT
TTTGTATTACAAAATCTAGAAGTTTACAAAAGCCAGATTGAGCATTATAAGACCTAGTAG
TAATAGATCAAAGAGGAGGATCTCAAGCTTTTAAAGTTCAAAAATTAAGATTAGGATGGA
AACTCTGGCAACGATGATGATGATGAAGAAAACAACTCAAATAAATAATAAGAATTATTA
AGGAGAGTCAATTAGATTAAGTAGCAAGTTTAATTGATAAAAAAAGTTGGTTCTAAGGTA
GAGAAAGATTTGAATTTGAACGAAGATGAAAACAAAAAGAATGGACTTTCTGAATAGCAA
GTGAAAGAAGAGTAATTAAGAACGATTACTGAAGAATAGGTTAAGTATTAAAATTTAGTA
TTTAACATGGACTACCAGTTAGATTTAAATGAGAGTGGTGGCCATAGAAGACACAGAAGA
GAAACAGATTATGATACTGAAAAATGGTTTGAAATATCTCATGACCAAAAAAATTATGTA
TCAATTTACGCCAACTAAAAGACATCATATTGTTGGTGGCTTAAAGATTATTTTAATAAA
AACAATTATGATCATCTTAATGTAAGCATTAACAGACTAGAAACTGAAGCCGAATTCTAT
GCCTTTGATGATTTTTCACAAACAATCAAACTTACTAATAATTCTTACTAGACTGTTAAC
ATAGACGTTAATTTTGATAATAATCTCTGTATACTCGCATTGCTTAGATTTTTATTATCA
CTAGAAAGATTCAATATTTTGAATATAAGATCTTCTTATACAAGAAATTAATATAATTTT
GAGAAAATTGGTGAGCTACTTGAAACTATCTTCGCAGTTGTCTTTTCTCATCGCCACTTA
CAAGGCATTCATTTACAAGTTCCTTGCGAAGCGTTCTAATATTTAGTTAACTCCTCATCA
TAAATTAGCGTTAAAGATAGCTAATTATAGGTATACTCTTTCTCTACAGACTTAAAATTA
GTTGACACTAACAAAGTCCAAGATTATTTTAAGTTCTTATAAGAATTCCCTCGTTTGACT
CATGTAAGCTAGTAGGCTATCCCAGTTAGTGCTACTAACGCTGTAGAGAACCTCAATGTT
TTACTTAAAAAGGTCAAGCATGCTAATCTTAATTTAGTTTCTATCCCTACCTAATTCAAT
TTTGATTTCTACTTTGTTAATTTATAACATTTGAAATTAGAGTTTGGATTAGAACCAAAT
ATTTTGACAAAACAAAAGCTTGAAAATCTACTTTTGAGTATAAAATAATCAAAAAATCTT
AAATTTTTAAGATTAAACTTTTACACCTACGTTGCTTAAGAAACCTCCAGAAAACAGATA
TTAAAACAAGCTACAACAATCAAAAATCTCAAAAACAATAAAAATCAAGAAGAAACTCCT
GAAACTAAAGATGAAACTCCAAGCGAAAGCACAAGTGGTATGAAATTTTTTGATCATCTT
TCTGAATTAACCGAGCTTGAAGATTTCAGCGTTAACTTGTAAGCTACCCAAGAAATTTAT
GATAGCTTGCACAAACTTTTGATTAGATCAACAAATTTAAAGAAGTTCAAATTAAGTTAC
AAATATGAAATGGAAAAGAGTAAAATGGATACATTCATAGATCTTAAGAATATTTATGAA
ACCTTAAACAATCTTAAAAGATGCTCTGTTAATATATCAAATCCTCATGGAAACATTTCT
TATGAACTGACAAATAAAGATTCTACTTTTTATAAATTTAAGCTGACCTTAAACTAAGAA
TTATAACACGCTAAGTATACTTTTAAGTAGAACGAATTTTAATTTAATAACGTTAAAAGT
GCAAAAATTGAATCTTCCTCATTAGAAAGCTTAGAAGATATTGATAGTCTTTGCAAATCT
ATTGCTTCTTGTAAAAATTTACAAAATGTTAATATTATCGCCAGTTTGCTCTATCCCAAC
AATATTTAGAAAAATCCTTTCAATAAGCCCAATCTTCTATTTTTCAAGCAATTTGAATAA
TTGAAAAATTTGGAAAATGTATCTATCAACTGTATTCTTGATCAGCATATACTTAATTCT
ATTTCAGAATTCTTAGAAAAGAATAAAAAAATAAAAGCATTCATTTTGAAAAGATATTAT
TTATTACAATATTATCTTGATTATACTAAATTATTTAAAACACTTCAATAGTTACCTGAA
TTAAATTAAGTTTACATTAATTAGCAATTAGAAGAATTGACTGTGAGTGAAGTACATAAG
TAAGTATGGGAAAACCACAAGCAAAAAGCTTTCTATGAACCATTATGTGAGTTTATCAAA
GAATCATCCTAAACCCTTTAGCTAATAGATTTTGACCAAAACACTGTAAGTGATGACTCT
ATTAAAAAGATTTTAGAATCTATATCTGAGTCTAAGTATCATCATTATTTGAGATTGAAC
CCTAGTTAATCTAGCAGTTTAATTAAATCTGAAAACGAAGAAATTTAAGAACTTCTCAAA
GCTTGCGACGAAAAAGGTGTTTTAGTAAAAGCATACTATAAATTCCCTCTATGTTTACCA
ACTGGTACTTATTACGATTACAATTCAGATAGATGGTGA


>TTHERM_00985160(protein)
MSRRNQKKPQAPIGNETNLDFVLQNLEVYKSQIEHYKTQQQQIKEEDLKLLKFKNQDQDG
NSGNDDDDEENNSNKQQELLRRVNQIKQQVQLIKKVGSKVEKDLNLNEDENKKNGLSEQQ
VKEEQLRTITEEQVKYQNLVFNMDYQLDLNESGGHRRHRRETDYDTEKWFEISHDQKNYV
SIYANQKTSYCWWLKDYFNKNNYDHLNVSINRLETEAEFYAFDDFSQTIKLTNNSYQTVN
IDVNFDNNLCILALLRFLLSLERFNILNIRSSYTRNQYNFEKIGELLETIFAVVFSHRHL
QGIHLQVPCEAFQYLVNSSSQISVKDSQLQVYSFSTDLKLVDTNKVQDYFKFLQEFPRLT
HVSQQAIPVSATNAVENLNVLLKKVKHANLNLVSIPTQFNFDFYFVNLQHLKLEFGLEPN
ILTKQKLENLLLSIKQSKNLKFLRLNFYTYVAQETSRKQILKQATTIKNLKNNKNQEETP
ETKDETPSESTSGMKFFDHLSELTELEDFSVNLQATQEIYDSLHKLLIRSTNLKKFKLSY
KYEMEKSKMDTFIDLKNIYETLNNLKRCSVNISNPHGNISYELTNKDSTFYKFKLTLNQE
LQHAKYTFKQNEFQFNNVKSAKIESSSLESLEDIDSLCKSIASCKNLQNVNIIASLLYPN
NIQKNPFNKPNLLFFKQFEQLKNLENVSINCILDQHILNSISEFLEKNKKIKAFILKRYY
LLQYYLDYTKLFKTLQQLPELNQVYINQQLEELTVSEVHKQVWENHKQKAFYEPLCEFIK
ESSQTLQLIDFDQNTVSDDSIKKILESISESKYHHYLRLNPSQSSSLIKSENEEIQELLK
ACDEKGVLVKAYYKFPLCLPTGTYYDYNSDRW


>TTHERM_00985160(gene)
ATGTCAAGGCGTAACTAAAAAAAGCCATAGGCTCCTATAGGCAATGAAACAAATCTTGAT
TTTGTATTACAAAATCTAGAAGTTTACAAAAGCCAGATTGAGCATTATAAGACCTAGTAG
TAATAGATCAAAGAGGAGGATCTCAAGCTTTTAAAGTTCAAAAATTAAGATTAGGATGGA
AACTCTGGCAACGATGATGATGATGAAGAAAACAACTCAAATAAATAATAAGAATTATTA
AGGAGAGTCAATTAGATTAAGTAGCAAGTTTAATTGATAAAAAAAGTTGGTTCTAAGGTA
GAGAAAGATTTGAATTTGAACGAAGATGAAAACAAAAAGAATGGACTTTCTGAATAGCAA
GTGAAAGAAGAGTAATTAAGAACGATTACTGAAGAATAGGTTAAGTATTAAAATTTAGTA
TTTAACATGGACTACCAGTTAGATTTAAATGAGAGTGGTGGCCATAGAAGACACAGAAGA
GAAACAGATTATGATACTGAAAAATGGTTTGAAATATCTCATGACCAAAAAAATTATGTA
TCAATTTACGCCAACTAAAAGACATCATATTGTTGGTGGCTTAAAGATTATTTTAATAAA
AACAATTATGATCATCTTAATGTAAGCATTAACAGACTAGAAACTGAAGCCGAATTCTAT
GCCTTTGATGATTTTTCACAAACAATCAAACTTACTAATAATTCTTACTAGACTGTTAAC
ATAGACGTTAATTTTGATAATAATCTCTGTATACTCGCATTGCTTAGATTTTTATTATCA
CTAGAAAGATTCAATATTTTGAATATAAGATCTTCTTATACAAGAAATTAATATAATTTT
GAGAAAATTGGTGAGCTACTTGAAACTATCTTCGCAGTTGTCTTTTCTCATCGCCACTTA
CAAGGCATTCATTTACAAGTTCCTTGCGAAGCGTTCTAATATTTAGTTAACTCCTCATCA
TAAATTAGCGTTAAAGATAGCTAATTATAGGTATACTCTTTCTCTACAGACTTAAAATTA
GTTGACACTAACAAAGTCCAAGATTATTTTAAGTTCTTATAAGAATTCCCTCGTTTGACT
CATGTAAGCTAGTAGGCTATCCCAGTTAGTGCTACTAACGCTGTAGAGAACCTCAATGTT
TTACTTAAAAAGGTCAAGCATGCTAATCTTAATTTAGTTTCTATCCCTACCTAATTCAAT
TTTGATTTCTACTTTGTTAATTTATAACATTTGAAATTAGAGTTTGGATTAGAACCAAAT
ATTTTGACAAAACAAAAGCTTGAAAATCTACTTTTGAGTATAAAATAATCAAAAAATCTT
AAATTTTTAAGATTAAACTTTTACACCTACGTTGCTTAAGAAACCTCCAGAAAACAGATA
TTAAAACAAGCTACAACAATCAAAAATCTCAAAAACAATAAAAATCAAGAAGAAACTCCT
GAAACTAAAGATGAAACTCCAAGCGAAAGCACAAGTGGTATGAAATTTTTTGATCATCTT
TCTGAATTAACCGAGCTTGAAGATTTCAGCGTTAACTTGTAAGCTACCCAAGAAATTTAT
GATAGCTTGCACAAACTTTTGATTAGATCAACAAATTTAAAGAAGTTCAAATTAAGTTAC
AAATATGAAATGGAAAAGAGTAAAATGGATACATTCATAGATCTTAAGAATATTTATGAA
ACCTTAAACAATCTTAAAAGATGCTCTGTTAATATATCAAATCCTCATGGAAACATTTCT
TATGAACTGACAAATAAAGATTCTACTTTTTATAAATTTAAGCTGACCTTAAACTAAGAA
TTATAACACGCTAAGTATACTTTTAAGTAGAACGAATTTTAATTTAATAACGTTAAAAGT
GCAAAAATTGAATCTTCCTCATTAGAAAGCTTAGAAGATATTGATAGTCTTTGCAAATCT
ATTGCTTCTTGTAAAAATTTACAAAATGTTAATATTATCGCCAGTTTGCTCTATCCCAAC
AATATTTAGAAAAATCCTTTCAATAAGCCCAATCTTCTATTTTTCAAGCAATTTGAATAA
TTGAAAAATTTGGAAAATGTATCTATCAACTGTATTCTTGATCAGCATATACTTAATTCT
ATTTCAGAATTCTTAGAAAAGAATAAAAAAATAAAAGCATTCATTTTGAAAAGATATTAT
TTATTACAATATTATCTTGATTATACTAAATTATTTAAAACACTTCAATAGTTACCTGAA
TTAAATTAAGTTTACATTAATTAGCAATTAGAAGAATTGACTGTGAGTGAAGTACATAAG
TAAGTATGGGAAAACCACAAGCAAAAAGCTTTCTATGAACCATTATGTGAGTTTATCAAA
GAATCATCCTAAACCCTTTAGCTAATAGATTTTGACCAAAACACTGTAAGTGATGACTCT
ATTAAAAAGATTTTAGAATCTATATCTGAGTCTAAGTATCATCATTATTTGAGATTGAAC
CCTAGTTAATCTAGCAGTTTAATTAAATCTGAAAACGAAGAAATTTAAGAACTTCTCAAA
GCTTGCGACGAAAAAGGTGTTTTAGTAAAAGCATACTATAAATTCCCTCTATGTTTACCA
ACTGGTACTTATTACGATTACAATTCAGATAGATGGTGA