Identifiers and Description

Gene Model Identifier

TTHERM_00429730

Standard Name

TTP80 (Tetrahymena Thermophila Protein)

Aliases

PreTt26414 | 48.m00177 | 3831.m01522

Description

Protein that complexes with p95, initially isolated by telomerase association, but deletion results in telomere lengthening without affecting telomerase stability or activity

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.4%

TetraMine Data

TTHERM_00429730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04118.19.997093137033517e-262TROVE domain-containing protei
n (716 aa)
DictyBaseDDB_G02930702.000364041471746e-45DDB_G0293070 on chromosome: 6
position 2426564 to 2433958
Stentor CoeruleusSteCoe_336566.639677199580735e-36

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15701761: Poderycki MJ, Rome LH, Harrington L, Kickhoefer VA (2005) The p80 homology region of TEP1 is sufficient for its association with the telomerase and vault RNAs, and the vault particle. Nucleic acids research 33(3):893-902
  2. Ref:14563212: Bateman A, Kickhoefer V (2003) The TROVE module: a common element in Telomerase, Ro and Vault ribonucleoproteins. BMC bioinformatics 4( ):49
  3. Ref:11592988: Mason DX, Autexier C, Greider CW (2001) Tetrahymena proteins p80 and p95 are not core telomerase components. Proceedings of the National Academy of Sciences of the United States of America 98(22):12368-73
  4. Ref:11027287: Liu Y, Snow BE, Hande MP, Baerlocher G, Kickhoefer VA, Yeung D, Wakeham A, Itie A, Siderovski DP, Lansdorp PM, Robinson MO, Harrington L (2000) Telomerase-associated protein TEP1 is not essential for telomerase activity or telomere length maintenance in vivo. Molecular and cellular biology 20(21):8178-84
  5. Ref:11090621: Miller MC, Collins K (2000) The Tetrahymena p80/p95 complex is required for proper telomere length maintenance and micronuclear genome stability. Molecular cell 6(4):827-37
  6. Ref:10551828: Kickhoefer VA, Stephen AG, Harrington L, Robinson MO, Rome LH (1999) Vaults and telomerase share a common subunit, TEP1. The Journal of biological chemistry 274(46):32712-7
  7. Ref:9485011: Ramakrishnan S, Eppenberger U, Mueller H, Shinkai Y, Narayanan R (1998) Expression profile of the putative catalytic subunit of the telomerase gene. Cancer research 58(4):622-5
  8. Ref:9671704: Collins K, Gandhi L (1998) The reverse transcriptase component of the Tetrahymena telomerase ribonucleoprotein complex. Proceedings of the National Academy of Sciences of the United States of America 95(15):8485-90
  9. Ref:9499406: Gandhi L, Collins K (1998) Interaction of recombinant Tetrahymena telomerase proteins p80 and p95 with telomerase RNA and telomeric DNA substrates. Genes & development 12(5):721-33
  10. Ref:9398860: Weinrich SL, Pruzan R, Ma L, Ouellette M, Tesmer VM, Holt SE, Bodnar AG, Lichtsteiner S, Kim NW, Trager JB, Taylor RD, Carlos R, Andrews WH, Wright WE, Shay JW, Harley CB, Morin GB (1997) Reconstitution of human telomerase with the template RNA component hTR and the catalytic protein subunit hTRT. Nature genetics 17(4):498-502
  11. Ref:9328462: Kipling D (1997) Mammalian telomerase: catalytic subunit and knockout mice. Human molecular genetics 6(12):1999-2004
  12. Ref:9294165: Ramakrishnan S, Sharma HW, Farris AD, Kaufman KM, Harley JB, Collins K, Pruijn GJ, van Venrooij WJ, Martin ML, Narayanan R (1997) Characterization of human telomerase complex. Proceedings of the National Academy of Sciences of the United States of America 94(19):10075-9
  13. Ref:9255061: Shore D (1997) Telomerase and telomere-binding proteins: controlling the endgame. Trends in biochemical sciences 22(7):233-5
  14. Ref:9118230: Nakayama J, Saito M, Nakamura H, Matsuura A, Ishikawa F (1997) TLP1: a gene encoding a protein component of mammalian telomerase is a novel member of WD repeats family. Cell 88(6):875-84
  15. Ref:9020079: Harrington L, McPhail T, Mar V, Zhou W, Oulton R, Bass MB, Arruda I, Robinson MO (1997) A mammalian telomerase-associated protein. Science (New York, N.Y.) 275(5302):973-7
  16. Ref:7774009: Collins K, Kobayashi R, Greider CW (1995) Purification of Tetrahymena telomerase and cloning of genes encoding the two protein components of the enzyme. Cell 81(5):677-86

Sequences

>TTHERM_00429730(coding)
ATGGAAATTGAAAACAACTAAGCACAATAGCCAAAAGCCGAAAAATTGTGGTGGGAACTT
GAATTAGAGATGCAAGAAAACCAAAATGATATATAAGTTAGGGTTAAGATTGACGATCCT
AAGCAATATCTCGTGAACGTCACTGCAGCATGTTTGTTGTAGGAAGGTAGTTACTACTAA
GATAAAGATGAAAGAAGATATATCATCACTAAAGCACTTCTTGAGGTGGCTGAGTCTGAT
CCTGAGTTCATCTGCTAGTTGGCAGTCTACATCCGTAATGAACTTTACATCAGAACTACC
ACTAACTACATTGTAGCATTTTGTGTTGTCCACAAGAATACTCAACCATTCATCGAAAAG
TACTTCAACAAAGCAGTACTTTTGCCTAATGACTTACTGGAAGTCTGTGAATTTGCATAG
GTTCTCTATATTTTTGATGCAACTGAATTCAAAAATTTGTATCTTGATAGGATACTTTCA
TAAGATATTCGTAAGGAACTCACTTTCCGTAAGTGTTTACAAAGATGCGTCAGAAGCAAG
TTTTCTGAATTCAACGAATACTAACTTGGTAAGTATTGCACTGAATCCTAACGTAAGAAA
ACAATGTTCCGTTACCTCTCAGTTACCAACAAGTAAAAGTGGGATTAAACTAAGAAGAAG
AGAAAAGAGAATCTCTTAACCAAACTTTAGGCAATAAAGGAATCTGAAGATAAGTCCAAG
AGAGAAACTGGAGACATAATGAACGTTGAAGATGCAATCAAGGCTTTAAAACCAGCAGTT
ATGAAGAAAATAGCCAAGAGATAGAATGCCATGAAGAAACACATGAAGGCACCTAAAATT
CCTAACTCTACCTTGGAATCAAAGTACTTGACCTTCAAGGATCTCATTAAGTTCTGCCAT
ATTTCTGAGCCTAAAGAAAGAGTCTATAAGATCCTTGGTAAAAAATACCCTAAGACCGAA
GAGGAATACAAAGCAGCCTTTGGTGATTCTGCATCTGCACCCTTCAATCCTGAATTGGCT
GGAAAGCGTATGAAGATTGAAATCTCTAAAACATGGGAAAATGAACTCAGTGCAAAAGGC
AACACTGCTGAGGTTTGGGATAATTTAATTTCAAGCAATTAACTCCCATATATGGCCATG
TTACGTAACTTGTCTAACATCTTAAAAGCCGGTGTTTCAGATACTACACACTCTATTGTG
ATCAACAAGATTTGTGAGCCCAAGGCCGTTGAGAACTCCAAGATGTTCCCTCTTCAATTC
TTTAGTGCCATTGAAGCTGTTAATGAAGCAGTTACTAAGGGATTCAAGGCCAAGAAGAGA
GAAAATATGAATCTTAAAGGTCAAATCGAAGCAGTAAAGGAAGTTGTTGAAAAAACCGAT
GAAGAGAAGAAAGATATGGAGTTGGAGTAAACCGAAGAAGGAGAATTTGTTAAAGTCAAC
GAAGGAATTGGCAAGCAATACATTAACTCCATTGAACTTGCAATCAAGATAGCAGTTAAC
AAGAATTTAGATGAAATCAAAGGACACACTGCAATCTTCTCTGATGTTTCTGGTTCTATG
AGTACCTCAATGTCAGGTGGAGCCAAGAAGTATGGTTCCGTTCGTACTTGTCTCGAGTGT
GCATTAGTCCTTGGTTTGATGGTAAAATAACGTTGTGAAAAGTCCTCATTCTACATCTTC
AGTTCACCTAGTTCTCAATGCAATAAGTGTTACTTAGAAGTTGATCTCCCTGGAGACGAA
CTCCGTCCTTCTATGTAAAAACTTTTGCAAGAGAAAGGAAAACTTGGTGGTGGTACTGAT
TTCCCCTATGAGTGCATTGATGAATGGACAAAGAATAAAACTCACGTAGACAATATCGTT
ATTTTGTCTGATATGATGATTGCAGAAGGATATTCAGATATCAATGTTAGAGGCAGTTCC
ATTGTTAACAGCATCAAAAAGTACAAGGATGAAGTAAATCCTAACATTAAAATCTTTGCA
GTTGACTTAGAAGGTTACGGAAAGTGCCTTAATCTAGGTGATGAGTTCAATGAAAACAAC
TACATCAAGATATTCGGTATGAGCGATTCAATCTTAAAGTTCATTTCAGCCAAGCAAGGA
GGAGCAAATATGGTCGAAGTTATCAAAAACTTTGCCCTTCAAAAAATAGGACAAAAGTGA


>TTHERM_00429730(protein)
MEIENNQAQQPKAEKLWWELELEMQENQNDIQVRVKIDDPKQYLVNVTAACLLQEGSYYQ
DKDERRYIITKALLEVAESDPEFICQLAVYIRNELYIRTTTNYIVAFCVVHKNTQPFIEK
YFNKAVLLPNDLLEVCEFAQVLYIFDATEFKNLYLDRILSQDIRKELTFRKCLQRCVRSK
FSEFNEYQLGKYCTESQRKKTMFRYLSVTNKQKWDQTKKKRKENLLTKLQAIKESEDKSK
RETGDIMNVEDAIKALKPAVMKKIAKRQNAMKKHMKAPKIPNSTLESKYLTFKDLIKFCH
ISEPKERVYKILGKKYPKTEEEYKAAFGDSASAPFNPELAGKRMKIEISKTWENELSAKG
NTAEVWDNLISSNQLPYMAMLRNLSNILKAGVSDTTHSIVINKICEPKAVENSKMFPLQF
FSAIEAVNEAVTKGFKAKKRENMNLKGQIEAVKEVVEKTDEEKKDMELEQTEEGEFVKVN
EGIGKQYINSIELAIKIAVNKNLDEIKGHTAIFSDVSGSMSTSMSGGAKKYGSVRTCLEC
ALVLGLMVKQRCEKSSFYIFSSPSSQCNKCYLEVDLPGDELRPSMQKLLQEKGKLGGGTD
FPYECIDEWTKNKTHVDNIVILSDMMIAEGYSDINVRGSSIVNSIKKYKDEVNPNIKIFA
VDLEGYGKCLNLGDEFNENNYIKIFGMSDSILKFISAKQGGANMVEVIKNFALQKIGQK


>TTHERM_00429730(gene)
ATGGAAATTGAAAACAACTAAGCACAATAGCCAAAAGCCGAAAAATTGTGGTGGGAACTT
GAATTAGAGATGCAAGAAAACCAAAATGATATATAAGTTAGGGTTAAGATTGACGATCCT
AAGCAATATCTCGTGAACGTCACTGCAGCATGTTTGTTGTAGGAAGGTAGTTACTACTAA
GATAAAGATGAAAGAAGATATATCATCACTAAAGCACTTCTTGAGGTGGCTGAGTCTGAT
CCTGAGTTCATCTGCTAGTTGGCAGTCTACATCCGTAATGAACTTTACATCAGAACTACC
ACTAACTACATTGTAGCATTTTGTGTTGTCCACAAGAATACTCAACCATTCATCGAAAAG
TACTTCAACAAAGCAGTACTTTTGCCTAATGACTTACTGGAAGTCTGTGAATTTGCATAG
GTTCTCTATATTTTTGATGCAACTGAATTCAAAAATTTGTATCTTGATAGGATACTTTCA
TAAGATATTCGTAAGGAACTCACTTTCCGTAAGTGTTTACAAAGATGCGTCAGAAGCAAG
TTTTCTGAATTCAACGAATACTAACTTGGTAAGTATTGCACTGAATCCTAACGTAAGAAA
ACAATGTTCCGTTACCTCTCAGTTACCAACAAGTAAAAGTGGGATTAAACTAAGAAGAAG
AGAAAAGAGAATCTCTTAACCAAACTTTAGGCAATAAAGGAATCTGAAGATAAGTCCAAG
AGAGAAACTGGAGACATAATGAACGTTGAAGATGCAATCAAGGCTTTAAAACCAGCAGTT
ATGAAGAAAATAGCCAAGAGATAGAATGCCATGAAGAAACACATGAAGGCACCTAAAATT
CCTAACTCTACCTTGGAATCAAAGTACTTGACCTTCAAGGATCTCATTAAGTTCTGCCAT
ATTTCTGAGCCTAAAGAAAGAGTCTATAAGATCCTTGGTAAAAAATACCCTAAGACCGAA
GAGGAATACAAAGCAGCCTTTGGTGATTCTGCATCTGCACCCTTCAATCCTGAATTGGCT
GGAAAGCGTATGAAGATTGAAATCTCTAAAACATGGGAAAATGAACTCAGTGCAAAAGGC
AACACTGCTGAGGTTTGGGATAATTTAATTTCAAGCAATTAACTCCCATATATGGCCATG
TTACGTAACTTGTCTAACATCTTAAAAGCCGGTGTTTCAGATACTACACACTCTATTGTG
ATCAACAAGATTTGTGAGCCCAAGGCCGTTGAGAACTCCAAGATGTTCCCTCTTCAATTC
TTTAGTGCCATTGAAGCTGTTAATGAAGCAGTTACTAAGGGATTCAAGGCCAAGAAGAGA
GAAAATATGAATCTTAAAGGTCAAATCGAAGCAGTAAAGGAAGTTGTTGAAAAAACCGAT
GAAGAGAAGAAAGATATGGAGTTGGAGTAAACCGAAGAAGGAGAATTTGTTAAAGTCAAC
GAAGGAATTGGCAAGCAATACATTAACTCCATTGAACTTGCAATCAAGATAGCAGTTAAC
AAGAATTTAGATGAAATCAAAGGACACACTGCAATCTTCTCTGATGTTTCTGGTTCTATG
AGTACCTCAATGTCAGGTGGAGCCAAGAAGTATGGTTCCGTTCGTACTTGTCTCGAGTGT
GCATTAGTCCTTGGTTTGATGGTAAAATAACGTTGTGAAAAGTCCTCATTCTACATCTTC
AGTTCACCTAGTTCTCAATGCAATAAGTGTTACTTAGAAGTTGATCTCCCTGGAGACGAA
CTCCGTCCTTCTATGTAAAAACTTTTGCAAGAGAAAGGAAAACTTGGTGGTGGTACTGAT
TTCCCCTATGAGTGCATTGATGAATGGACAAAGAATAAAACTCACGTAGACAATATCGTT
ATTTTGTCTGATATGATGATTGCAGAAGGATATTCAGATATCAATGTTAGAGGCAGTTCC
ATTGTTAACAGCATCAAAAAGTACAAGGATGAAGTAAATCCTAACATTAAAATCTTTGCA
GTTGACTTAGAAGGTTACGGAAAGTGCCTTAATCTAGGTGATGAGTTCAATGAAAACAAC
TACATCAAGATATTCGGTATGAGCGATTCAATCTTAAAGTTCATTTCAGCCAAGCAAGGA
GGAGCAAATATGGTCGAAGTTATCAAAAACTTTGCCCTTCAAAAAATAGGACAAAAGTGA