Identifiers and Description

Gene Model Identifier

TTHERM_00545820

Standard Name

TTNC (Tetrin C )

Aliases

PreTt15032 | 71.m00159 | Tetrin C | 3729.m00037

Description

Tetrin C; novel, insoluble cytoskeletal protein with molecular mass of around 85 kD; unique to ciliates

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( PF02524 ) KID repeat
  • ( PF01576 ) Myosin tail
  • ( PF08581 ) Tup N-terminal
  • ( PF02370 ) M protein repeat
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF00038 ) Intermediate filament protein
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06435 ) Repeat of unknown function (DUF1079)
  • ( PF06160 ) septation ring formation regulator EzrA
  • ( PF04728 ) Repeated sequence found in lipoprotein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00545820

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17036.19.997093137033517e-262tetrin C protein (768 aa)
OxytrichaContig9177.0.g50.0000000000006997872742366828GCC2 and GCC3

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15134263: McLaughlin NB, Buhse HE (2004) Localization by indirect immunofluorescence of tetrin, actin, and centrin to the oral apparatus and buccal cavity of the macrostomal form of Tetrahymena vorax. The Journal of eukaryotic microbiology 51(2):253-7
  2. Ref:12674474: Honts JE, Williams NE (2003) Novel cytoskeletal proteins in the cortex of Tetrahymena. The Journal of eukaryotic microbiology 50(1):9-14
  3. Ref:12095113: Clerot J, Iftode F, Budin K, Jeanmaire-Wolf R, Coffe G, Fleury-Aubusson A (2002) Fine oral filaments in Paramecium: a biochemical and immunological analysis. The Journal of eukaryotic microbiology 48(2):234-45
  4. Ref:10965956: Brimmer A, Weber K (2000) The cDNA sequences of three tetrins, the structural proteins of the Tetrahymena oral filaments, show that they are novel cytoskeletal proteins. Protist 151(2):171-80
  5. Ref:1476826: Dress VM, Yi H, Musal MR, Williams NE (1993) Tetrin polypeptides are colocalized in the cortex of Tetrahymena. Journal of structural biology 108(3):187-94
  6. Ref:2211871: Honts JE, Williams NE (1990) Tetrins: polypeptides that form bundled filaments in Tetrahymena. Journal of cell science 96 ( Pt 2)( ):293-302

Sequences

>TTHERM_00545820(coding)
ATGAGCAGCTACGTACGCAACAATCCCCATTCTTCTGGTGTTTAAAATAACACTACCAGT
TCTCCAAACAGATCTATTAGTCCTATCCACTACGTCAAGCCTTCTTCTGTCTACTACACC
TCTACTATCTCTCCTAGCAAATCTTTATAGAGCACTGCTAAGAAGTCTGTCTAACCTGTC
CGCCCTAACATTGAAGCTAGTCCTAACAAAAATCTTACCTTAGCCTAATAGGATGAAGTA
GACTTATGGAAGAGTCGTTGCAACGAGTTAGAAACTTCTCTCTGCTAAGTCAATACTGAT
CTTGAACTCGCTTCATTCAAGGCTAAGAAAGCTAAAGATCTTGAAAGCAAGGTTGATGAT
ATTCTCAAGCAAAATGCCCAACTTTTAGGTGAAAACGACTAACTTTCCAAATAATTCTCC
TAAAAGAGAACTGAATCTGATATCTGGAAGAGCAAATATGATGCTTAAATGAATACAATC
CTTTCTCTCAAGGACAATTACGAAAGAGAAATCAAGAGATTACAAAATGAATTATCTCAA
TCCAGAGAACTTTACGATGGTCTCTAACAAGAAAGACTTAAAGAAGCTTAAGAAACTAAA
TAATAATTAATCCATGATAATCTCACCTAAATCGAATCTCTTAAGCGTTCCCACTGCTCT
AATGTTACTCTCTATGAAGAACAATTAAGAAAAATGAGAGATAACCTTGAAGAAAGAGAA
AAAGAAAACCTCAATTTATAAGGAAAATTGATGGATCTTAAGAATTACTCTGAAAGTGAA
TAAAATAGACTCAACGAAGACAGAGAAAAATTAAGAATGAAGATCTCTCAAATGGAACTT
GATCAATCAAAAGAACTTGAAAACTTGAAGAGAAGATGTGATGGTCTTACTTTAGAATAA
ATTAGTGCTTTAAAGAAATTACACGAAAGTGAATTAGATGTTCTTGAAAGTGAACTTAAC
AAGCTCAAGAACTTACTCGATATCAAGAACTAAGAAATTGGTACTCTCATCTAGTAAAAT
AAATCATAAAAGCGTAATTTCGATAATGAACTATAATCCGTTCGTGATGAAAATGAAGCT
CTCAAGGACAAAATTTTAGAAAATAACCGTTGCAAGGAAGATGAAATTGATGATATCTAA
AATAAACTCGCTAAGCTTCATACCACTGATATCTAAAACTTGAAGGATCGTCATGATAAT
CAAGTTAAGATGCTCAATGATTAAATCAACGACTTGAAGAGAGTTATTGATCTTAAGTAA
GAGGAAATCGAAAACTAAATCAGAGAAAAGAACAACTAAAGAGATGCATTCAATGCTAAG
TGTGATAGACTTAATAGCGATATTGAAACCTAAAAGTTAAAATACTAAGTCCTTGAAGAA
GACAGAAAGAAAGATTATGATGAAGCCACTGAAGCCCTTAACCGTGCTAACAGTGCTCAT
GCTGAGTTCTCTGAATAACAAAGAAGATAAATTTAATTCCTTGAAAGTGAAATTGAAAAG
TTAAAACAATTACTTGTACATAAGAACAATGAAATTGATATTAATATCGCTTAACACAGA
ACTATCAAGAACAATTTAGAAGAAGATATCAGACAACTCAAGCTCGACAATAGCGACCTC
AGAAAGAGACTTGACCAATTAGAATACTCTAAGAATCTTCAACTTGAAGAACTTCGTCAA
AAAGTAGTTGCTCTTGATAACAATAACTCAGAAAGAACCAAGAAATTCGAAGCTCAAATT
GACTATCTTGAAAATGAACTTAGCAGAGCTAGAGATAACTTGAAGATAAAGACAGAAGAA
ACCAACAGTCATTAAATCCATAGAAATCTCTTAGAAACTGAAAATAAGAAGCTTAATGCT
GAAATTGACAGCTTAAATAACCACATGGTCATGTTGGAGAAATTAAAAGCTTAAGAAATC
CAAGAATTAAGACACAAGTTAGAAAGCTCAAACAACTACACCATCGAGTCTATCAAGGCA
TCCCATAATAACTAATTAGAAGCTATGGCCAATGAAATTGAAGACTTGAAGAATATAATT
GAAATGAAGGACAGATAATTAGGAGAAAAGGCAGATTAATATTAAAAGCTTGAAAAATCC
TTAGTAGACATTTAAAACAACACTGACCTCTCTGATTACTAAATGAGAATTTCTAAGCTC
GGTGCTGAAGTTGCTACTACCAAGAACCTTTATGACGTTTTTGTCAAGACTAGACAACCT
TCTTATGGCTCTGGTAAAAAATTAATGCCCAATAACAGTGGTGTTTCTCCCATTAAGAAA
GTCAGTCAATTTTGA


>TTHERM_00545820(protein)
MSSYVRNNPHSSGVQNNTTSSPNRSISPIHYVKPSSVYYTSTISPSKSLQSTAKKSVQPV
RPNIEASPNKNLTLAQQDEVDLWKSRCNELETSLCQVNTDLELASFKAKKAKDLESKVDD
ILKQNAQLLGENDQLSKQFSQKRTESDIWKSKYDAQMNTILSLKDNYEREIKRLQNELSQ
SRELYDGLQQERLKEAQETKQQLIHDNLTQIESLKRSHCSNVTLYEEQLRKMRDNLEERE
KENLNLQGKLMDLKNYSESEQNRLNEDREKLRMKISQMELDQSKELENLKRRCDGLTLEQ
ISALKKLHESELDVLESELNKLKNLLDIKNQEIGTLIQQNKSQKRNFDNELQSVRDENEA
LKDKILENNRCKEDEIDDIQNKLAKLHTTDIQNLKDRHDNQVKMLNDQINDLKRVIDLKQ
EEIENQIREKNNQRDAFNAKCDRLNSDIETQKLKYQVLEEDRKKDYDEATEALNRANSAH
AEFSEQQRRQIQFLESEIEKLKQLLVHKNNEIDINIAQHRTIKNNLEEDIRQLKLDNSDL
RKRLDQLEYSKNLQLEELRQKVVALDNNNSERTKKFEAQIDYLENELSRARDNLKIKTEE
TNSHQIHRNLLETENKKLNAEIDSLNNHMVMLEKLKAQEIQELRHKLESSNNYTIESIKA
SHNNQLEAMANEIEDLKNIIEMKDRQLGEKADQYQKLEKSLVDIQNNTDLSDYQMRISKL
GAEVATTKNLYDVFVKTRQPSYGSGKKLMPNNSGVSPIKKVSQF


>TTHERM_00545820(gene)
ATGAGCAGCTACGTACGCAACAATCCCCATTCTTCTGGTGTTTAAAATAACACTACCAGT
TCTCCAAACAGATCTATTAGTCCTATCCACTACGTCAAGCCTTCTTCTGTCTACTACACC
TCTACTATCTCTCCTAGCAAATCTTTATAGAGCACTGCTAAGAAGTCTGTCTAACCTGTC
CGCCCTAACATTGAAGCTAGTCCTAACAAAAATCTTACCTTAGCCTAATAGGATGAAGTA
GACTTATGGAAGAGTCGTTGCAACGAGTTAGAAACTTCTCTCTGCTAAGTCAATACTGAT
CTTGAACTCGCTTCATTCAAGGCTAAGAAAGCTAAAGATCTTGAAAGCAAGGTTGATGAT
ATTCTCAAGCAAAATGCCCAACTTTTAGGTGAAAACGACTAACTTTCCAAATAATTCTCC
TAAAAGAGAACTGAATCTGATATCTGGAAGAGCAAATATGATGCTTAAATGAATACAATC
CTTTCTCTCAAGGACAATTACGAAAGAGAAATCAAGAGATTACAAAATGAATTATCTCAA
TCCAGAGAACTTTACGATGGTCTCTAACAAGAAAGACTTAAAGAAGCTTAAGAAACTAAA
TAATAATTAATCCATGATAATCTCACCTAAATCGAATCTCTTAAGCGTTCCCACTGCTCT
AATGTTACTCTCTATGAAGAACAAGTAAAAAATTATTTTAATTATAATAAAATTAAATAA
AAAAAAATGTGCAGATTTTTAAAAAATGATTTTTAGAAACTTTAAAAGCCATATTTTTTC
TAAATATTTGGCAACTTTACAAAAAAAAAGTTGATTTAATTATAAATTTAATTTTTTATT
TCTTTGATTTTTTATAAGCAAAGCTTTATTTACCAATAAATAAAATAATAATTAGCCATA
AGCAATAAAAATTAATAGCCCAGTATCAAAAATAATTCTTATTTACCACCTCAAAATATT
TAACCAAAATTTTTTCCTTCTATTTTTTTTTTTTGCGTAAAACAACTATAGCCATAAATT
AAATTCATTCACTTTTTTTTGTATTAAATTTTAATTTACTATAAATAGTTAAGAAAAATG
AGAGATAACCTTGAAGAAAGAGAAAAAGAAAACCTCAATTTATAAGGAAAATTGATGGAT
CTTAAGAATTACTCTGAAAGTGAATAAAATAGACTCAACGAAGACAGAGAAAAATTAAGA
ATGAAGATCTCTCAAATGGAACTTGATCAATCAAAAGAACTTGAAAACTTGAAGAGAAGA
TGTGATGGTCTTACTTTAGAATAAATTAGTGCTTTAAAGAAATTACACGAAAGTGAATTA
GATGTTCTTGAAAGTGAACTTAACAAGCTCAAGAACTTACTCGATATCAAGAACTAAGAA
ATTGGTACTCTCATCTAGTAAAATAAATCATAAAAGCGTAATTTCGATAATGAACTATAA
TCCGTTCGTGATGAAAATGAAGCTCTCAAGGACAAAATTTTAGAAAATAACCGTTGCAAG
GAAGATGAAATTGATGATATCTAAAATAAACTCGCTAAGCTTCATACCACTGATATCTAA
AACTTGAAGGATCGTCATGATAATCAAGTTAAGATGCTCAATGATTAAATCAACGACTTG
AAGAGAGTTATTGATCTTAAGTAAGAGGAAATCGAAAACTAAATCAGAGAAAAGAACAAC
TAAAGAGATGCATTCAATGCTAAGTGTGATAGACTTAATAGCGATATTGAAACCTAAAAG
TTAAAATACTAAGTCCTTGAAGAAGACAGAAAGAAAGATTATGATGAAGCCACTGAAGCC
CTTAACCGTGCTAACAGTGCTCATGCTGAGTTCTCTGAATAACAAAGAAGATAAATTTAA
TTCCTTGAAAGTGAAATTGAAAAGTTAAAACAATTACTTGTACATAAGAACAATGAAATT
GATATTAATATCGCTTAACACAGAACTATCAAGAACAATTTAGAAGAAGATATCAGACAA
CTCAAGCTCGACAATAGCGACCTCAGAAAGAGACTTGACCAATTAGAATACTCTAAGAAT
CTTCAACTTGAAGAACTTCGTCAAAAAGTAGTTGCTCTTGATAACAATAACTCAGAAAGA
ACCAAGAAATTCGAAGCTCAAATTGACTATCTTGAAAATGAACTTAGCAGAGCTAGAGGT
AAATAAATAAATATATTATAAATATAAATTAATAAATAATTATTGTTTAATTAATAATAG
ATAACTTGAAGATAAAGACAGAAGAAACCAACAGTCATTAAATCCATAGAAATCTCTTAG
AAACTGAAAATAAGAAGCTTAATGCTGAAATTGACAGCTTAAATAACCACATGGTCATGT
TGGAGAAATTAAAAGCTTAAGAAATCCAAGAATTAAGACACAAGTTAGAAAGCTCAAACA
ACTACACCATCGAGTCTATCAAGGCATCCCATAATAACTAATTAGAAGCTATGGCCAATG
AAATTGAAGACTTGAAGAATATAATTGAAATGAAGGACAGATAATTAGGAGAAAAGGCAG
ATTAATATTAAAAGCTTGAAAAATCCTTAGTAGACATTTAAAACAACACTGACCTCTCTG
ATTACTAAATGAGAATTTCTAAGCTCGGTGCTGAAGTTGCTACTACCAAGAACCTTTATG
ACGTTTTTGTCAAGACTAGACAACCTTCTTATGGCTCTGGTAAAAAATTAATGCCCAATA
ACAGTGGTGTTTCTCCCATTAAGAAAGTCAGTCAATTTTGA