Identifiers and Description

Gene Model Identifier

TTHERM_00474830

Standard Name

TTN4 (Tetrin D (Tetrin 4))

Aliases

PreTt02282 | 57.m00221 | 3709.m00081

Description

insoluble cytoskeletal protein localized to the oral apparatus, found in published pellicle proteome

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF06818 ) Fez1
  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( TIGR01807 ) chorismate mutase
  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF06705 ) SF-assemblin/beta giardin
  • ( PF05064 ) Nsp1-like C-terminal region
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR01145 ) ATP synthase F1, delta subunit
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF05911 ) Plant protein of unknown function
  • ( PF07334 ) Interferon-induced 35 kDa protein (IFP

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00474830

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13159.19.997093137033517e-262hypothetical protein (744 aa)
OxytrichaContig17309.0.g190.00010003404299092957HAMP domain
WormBaseWBGene000225000.00020003864201578029locus:lfi-1 status:Partially
_confirmed UniProt:H2L0I2
protein_id:CCD73129.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21127172: Gould SB, Kraft LG, van Dooren GG, Goodman CD, Ford KL, Cassin AM, Bacic A, McFadden GI, Waller RF (2011) Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. Molecular biology and evolution 28(3):1319-31

Sequences

>TTHERM_00474830(coding)
ATGTACAATAGCAGAAGTCCTTACACCTCTTCCCCTATCAAGAAAAACCCCTCAGTTGTT
AATCCTGTTAACACCAGTTACTCACGTAGCCCAATCAACTACTCCAGAACTCCTGAAACT
TCAAAGAAAACTGGCCCCAATTACGAAGGAGGTTTAAACTAAAGCACTGCCTACAAGAAT
AATATTATCGGTAATGGTGAAGAAATCGATTTATGGAAGAGCAGATGCAATGAACTTGAA
AGCAGCTTGTGCTAAGCTAACACTGACTTAGAATTGGCTCACTTCCGTGCTAAAAAGGCT
CTTGAGCTTGAACACAAATGCGAAGAATTAGTTCGTATGAATGGTAATCTATCTTAAGAA
AATGAAGGATTACAAAAGCAAACTAATTAGCGCAAAGCCGAAAGCGACATTTGGAGACAA
AAGTATGAAACTTAAATGAATAATATAATTTCTCTTAAGTCCAACTATGAAATGGAATTA
AAGCGTTTATCAACAGAAAATGCTCGTCTCCGCGATGAATTAAAGCAAGGAGAAATTGAT
AAGGTCAAGGAAAATGAAGATGTTCGTTTCAAATTGACCACAGACTCTCATGATAAGATA
GAAAACTTGAAGAAATCTCATCTTGCCAACATTGAACTCTACGAAGAATAACTCCGCAAA
CTTCGTAATATTGTCGAAGATCGTGAAAAGGAAATTGCTAAGCTCAGCAGCCAAATTTCT
CAAGCCCGCTACGATGGTTCTTCTGAAGCCTACCGTCTTAATGAAGATCGTGAAAAGTTG
AAGATGAAGATCTCTGAATTAGAAGTTGAAAGTCGCTAAGAACTTGAAAACTTAAGAAGC
AAACTCGACTAACAAGCCAGCGAATAGCTTGATTCCCTTAAGAAGTTGCATGATAATGAA
TTGGAAGTTATGAGTGGTGAAATCCATAAACTTCGTAACCTACTTGATGTTAAGACTAAA
GAAATAGAAGCTCTTATTGACTAAAACAGAGGATTAAAGCGCAATTATGAAGAAGAAACC
CACAACTTGCGTCATGACTTACAAGCCTTGAAGGACCGTATCGCTGATAACAATGATTTC
GCCAACAGTGAAATCTCTGCTCTCCATGATTAACTTCATAATCAACACACTTCTGACATT
TAAGGTTTAAAGTTCCACCACGAAAATCAAATCTAAGCCCTTAATGCTGAAAAGGATGAA
CTTTAAAATATTATTGATGCTAAGGAAGCAGAAATTCAAAACTAAATCCGCGAAAAGCAA
CTTGTACGTGATAGTCTTAATGATGAAATCAATCGTCTCATGGCTGACGTTGATAATTGG
AAAATAAAATATACTTACCTTGACAACTAACGCGCTTAAGAAAATTAAGAAGCAGCTATC
AAGTATGACACCCTCAACAACCAATAAAATGAATTCGCTTCTGCTCAACGCAATTAAATT
AAGTATCTCCAAGAAGAAATTGAAAATCTTAAATAGTTACTTCTTGCTAAGAATTAAGAA
ATTGATTCAAACCGTGCTCAACACGCTGAAATCCGTGACGGTCTTGAATAAGATATTTCT
AATGCCTTTGCTGAAATTGAAGAATGGAAGAAGAAGTATGCTCATCTCTAACATGAACGT
GATATCACAGTTGAAGATTTGAAGCTTAAGCTCTCTGTCTTAGAAACAAAGGCTAACGAA
CAAAAGAAGAAGTTAGAATCAACCATCAACTACTTAAAGGAAGACATTCAAAGACTTAAA
GATACCATCGAAATCAAGGAAAAAGAAGTTTAAAATCACTTGAAGCACAGAGAATTACAA
GACAGAGAAATCAAAAAACTCAAATAAGACAATGACAGTCAAAATGACCATCTTAGAAGA
TTAGAAAAGCTCAAGGCTAGTGAATTAGAAGATTAGAGAAAGAAATTAGAAACTTCTAAT
AATAACGTCATTGAATCTATTAAGATTTCTCATCAAAACTAAGTCAATATTATGAACACT
GAAATAAATGATCTCAAGCACCTTGTCAACTTAAAGGATTAAGAAGTTCACGATATGATC
AACAAATATGAAAAGTTAGAATCTGCAATTGGTGAATTTAAATACAACGCTGAAAAACTT
AAAGAACATCAATCTCAAATATAAGCTTTAGGAAACGAAATTATAAATAATAAGAGTATC
TATGATTCTTACTCCAAAGCTAGACACACAAGATATCCCTCTTCTGCTTCTAAGATCTAA
TAATGA


>TTHERM_00474830(protein)
MYNSRSPYTSSPIKKNPSVVNPVNTSYSRSPINYSRTPETSKKTGPNYEGGLNQSTAYKN
NIIGNGEEIDLWKSRCNELESSLCQANTDLELAHFRAKKALELEHKCEELVRMNGNLSQE
NEGLQKQTNQRKAESDIWRQKYETQMNNIISLKSNYEMELKRLSTENARLRDELKQGEID
KVKENEDVRFKLTTDSHDKIENLKKSHLANIELYEEQLRKLRNIVEDREKEIAKLSSQIS
QARYDGSSEAYRLNEDREKLKMKISELEVESRQELENLRSKLDQQASEQLDSLKKLHDNE
LEVMSGEIHKLRNLLDVKTKEIEALIDQNRGLKRNYEEETHNLRHDLQALKDRIADNNDF
ANSEISALHDQLHNQHTSDIQGLKFHHENQIQALNAEKDELQNIIDAKEAEIQNQIREKQ
LVRDSLNDEINRLMADVDNWKIKYTYLDNQRAQENQEAAIKYDTLNNQQNEFASAQRNQI
KYLQEEIENLKQLLLAKNQEIDSNRAQHAEIRDGLEQDISNAFAEIEEWKKKYAHLQHER
DITVEDLKLKLSVLETKANEQKKKLESTINYLKEDIQRLKDTIEIKEKEVQNHLKHRELQ
DREIKKLKQDNDSQNDHLRRLEKLKASELEDQRKKLETSNNNVIESIKISHQNQVNIMNT
EINDLKHLVNLKDQEVHDMINKYEKLESAIGEFKYNAEKLKEHQSQIQALGNEIINNKSI
YDSYSKARHTRYPSSASKIQQ


>TTHERM_00474830(gene)
ATGTACAATAGCAGAAGTCCTTACACCTCTTCCCCTATCAAGAAAAACCCCTCAGTTGTT
AATCCTGTTAACACCAGTTACTCACGTAGCCCAATCAACTACTCCAGAACTCCTGAAACT
TCAAAGAAAACTGGCCCCAATTACGAAGGAGGTTTAAACTAAAGCACTGCCTACAAGAAT
AATATTATCGGTAATGGTGAAGAAATCGATTTATGGAAGAGCAGATGCAATGAACTTGAA
AGCAGCTTGTGCTAAGCTAACACTGACTTAGAATTGGCTCACTTCCGTGCTAAAAAGGCT
CTTGAGCTTGAACACAAATGCGAAGAATTAGTTCGTATGAATGGTAATCTATCTTAAGAA
AATGAAGGATTACAAAAGCAAACTAATTAGCGCAAAGCCGAAAGCGACATTTGGAGACAA
AAGTATGAAACTTAAATGAATAATATAATTTCTCTTAAGTCCAACTATGAAATGGAATTA
AAGCGTTTATCAACAGAAAATGCTCGTCTCCGCGATGAATTAAAGCAAGGAGAAATTGAT
AAGGTCAAGGAAAATGAAGATGTTCGTTTCAAATTGACCACAGACTCTCATGATAAGATA
GAAAACTTGAAGAAATCTCATCTTGCCAACATTGAACTCTACGAAGAATAACTCCGCAAA
CTTCGTAATATTGTCGAAGATCGTGAAAAGGAAATTGCTAAGCTCAGCAGCCAAATTTCT
CAAGCCCGCTACGATGGTTCTTCTGAAGCCTACCGTCTTAATGAAGATCGTGAAAAGTTG
AAGATGAAGATCTCTGAATTAGAAGTTGAAAGTCGCTAAGAACTTGAAAACTTAAGAAGC
AAACTCGACTAACAAGCCAGCGAATAGCTTGATTCCCTTAAGAAGTTGCATGATAATGAA
TTGGAAGTTATGAGTGGTGAAATCCATAAACTTCGTAACCTACTTGATGTTAAGACTAAA
GAAATAGAAGCTCTTATTGACTAAAACAGAGGATTAAAGCGCAATTATGAAGAAGAAACC
CACAACTTGCGTCATGACTTACAAGCCTTGAAGGACCGTATCGCTGATAACAATGATTTC
GCCAACAGTGAAATCTCTGCTCTCCATGATTAACTTCATAATCAACACACTTCTGACATT
TAAGGTTTAAAGTTCCACCACGAAAATCAAATCTAAGCCCTTAATGCTGAAAAGGATGAA
CTTTAAAATATTATTGATGCTAAGGAAGCAGAAATTCAAAACTAAATCCGCGAAAAGCAA
CTTGTACGTGATAGTCTTAATGATGAAATCAATCGTCTCATGGCTGACGTTGATAATTGG
AAAATAAAATATACTTACCTTGACAACTAACGCGCTTAAGAAAATTAAGAAGCAGCTATC
AAGTATGACACCCTCAACAACCAATAAAATGAATTCGCTTCTGCTCAACGCAATTAAATT
AAGTATCTCCAAGAAGAAATTGAAAATCTTAAATAGTTACTTCTTGCTAAGAATTAAGAA
ATTGATTCAAACCGTGCTCAACACGCTGAAATCCGTGACGGTCTTGAATAAGATATTTCT
AATGCCTTTGCTGAAATTGAAGAATGGAAGAAGAAGTATGCTCATCTCTAACATGAACGT
GATATCACAGTTGAAGATTTGAAGCTTAAGCTCTCTGTCTTAGAAACAAAGGCTAACGAA
CAAAAGAAGAAGTTAGAATCAACCATCAACTACTTAAAGGAAGACATTCAAAGACTTAAA
GGTAAAATTTTTAATATTATTTAAATCAATAAAATTGCTTACATTTAAATTAATTTATTT
GTTGAAAATAAAAATTTTATTTAAACCTTTTATTTAATTTAAAAGATACCATCGAAATCA
AGGAAAAAGAAGTTTAAAATCACTTGAAGCACAGAGAATTACAAGACAGAGAAATCAAAA
AACTCAAATAAGACAATGACAGTCAAAATGACCATCTTAGAAGATTAGAAAAGCTCAAGG
CTAGTGAATTAGAAGATTAGAGAAAGAAATTAGAAACTTCTAATAATAACGTCATTGAAT
CTATTAAGATTTCTCATCAAAACTAAGTCAATATTATGAACACTGAAATAAATGATCTCA
AGCACCTTGTCAACTTAAAGGATTAAGAAGTTCACGATATGATCAACAAATATGAAAAGT
TAGAATCTGCAATTGGTGAATTTAAATACAACGCTGAAAAACTTAAAGAACATCAATCTC
AAATATAAGCTTTAGGAAACGAAATTATAAATAATAAGAGTATCTATGATTCTTACTCCA
AAGCTAGACACACAAGATATCCCTCTTCTGCTTCTAAGATCTAATAATGA