Identifiers and Description

Gene Model Identifier

TTHERM_00726050

Standard Name

TTN2 (Tetrahymena Tudor Nuclease 2)

Aliases

PreTt21871 | 117.m00123

Description

Tudor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.6%

TetraMine Data

TTHERM_00726050

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_167380
Tetrahymena borealisEI9_04596.19.997093137033517e-262tudor domain-containing protei
n (826 aa)
OxytrichaContig20252.0.g835.998312950603665e-35Staphylococcal nuclease homolo
gue
WormBaseWBGene000066260.000000000029994712494008525locus:tsn-1 status:Confirmed
UniProt:Q19328 protein_id
:CCD69204.1
DictyBaseDDB_G02796590.000019995566179747357snd1 on chromosome: 3 position
2397433 to 2400394

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17715366: Howard-Till RA, Yao MC (2007) Tudor nuclease genes and programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 6(10):1795-804

Sequences

>TTHERM_00726050(coding)
ATGAAGACTGGACTTTTAGCAAACATTATTTCAAGCAGAAATATTATTATATAGAAAAAA
AACAAGCCTCCTATTGAATTAAAATTAGCAAATTGGTAAAATATACCTTTGTTTGAATCA
TTTTCAAAAGATGATGAACCTGGTGGCTTAGAAGCAAAGCAGTTTTTGTGTTAATTTGTA
AGATAAAAAATAAAATTTTAAGTTGATAAATCAACCCAGGAAGTAGTTATATGGGATGAC
GAATAAGACTAATCAAAGAGTATTAATGATTAGTTACTATCTTTCTTAGCTTCTAATAAC
TTTAATAAGTAGTACTCTAAGACAATCAACGATTATACTGTTCCAATTTCAAGAGATTTA
TACAATTAAATAACTATTAAAGCTAATTAAACTTATGAATTTTTTTTTGATGAAATAAAT
TCTGAAGGATAGTTCATAGCTTTTGAAAAAAATACAAATACATTGATAGTTTTTTAACCA
TAATTTGTTAAAATACCTGTTATTGGTCCTTAGTATAAGTAATTCCTAGATGCCAATTTA
CTTGATAATCAAATACTCTCAAAAACTCATACAATTTGCATTTCCTCATTAGAATATGAT
TCAAAAAAAACTCTCATTTTTAATGGTCTATTTGATAAGATAAGTGTTCTATTAAAAGAT
GGTGTAGCAAGCTTAACAGATATGGCATTCCTCTCTATCAAAGATTAGGATTTACTTGAG
TAATATGATGAATATATATGCTAAGCATAAGCAGAAAACAAAGGTATTTGGGGTAAATAA
ACTGATTTTGATTCACTGATCACTAGAATAGATTCATTCCTTGGAATTGTACGCGAAGTT
GAATCTGGTATAGTTTTAGTTATAGAAAGAATAGGTGAAGAGCAAAGCTAGTCTAAGATG
ATAAAAATTTAGCTTAGTAAAATTTAATGTCCATAAGGATTAGAAAGAGGTGCTTTTGAA
GCGAGAGAGTATCTAAGAAAGCTTGTCATAGGTGCTGAAGTCGATGTTTTCTTAGAAAAA
GAATAGGGATTTTTGCAATGCGCCACTGTTATAATTTCTAGCTCTTAACTCAACTTAAAT
TAATATTTAGTAAGTAACGGATATGCAAAAATAAAAGAAGAATTCAAAGGAAATTTTACA
GACCACAAATGGATTTAGACTGAACTTGATTAGAAGCTAGCAATTTAAAATTAAAAAGGT
ATACATAATAAAGATTTGGGTATTATGAGATTAAAAGAGATTGGAGTAAAGGAGACATTA
GAATTATACTAAACTTAGATTAAATAAAACATGAATAAGGAATAGTATTAGTGTATAGTT
GAAAAAGTTCTCACTGGTGACAGATTACTTATGAGATTTATCAGCTTTAGTGTAATTGTC
AAAGTCAAATTATTTGGTATTAAATGTTTCCAAAATGATCCTAATTAGCCTACTCTGTAG
GAAAACTACAGGAAATCAATTGATTATAACTACAAGACTCTTATGAATAGAAATGTCTAA
GTTGACGTTATAGGCTTACATGATGGTTGCTTGTTGTGTAAAGTATATAATTAGAAAAAG
TAAGATTAATCCTAACTTCTCTTAGAAGAGGGTTTAGCCTATTTCAAATAAGAAACTGAT
AATTATGATTCAATTTATGAAGCCTGCTAGGAAAAAGCTAAATAGGAAAAAAGAGGTATT
TGGGAACATGAAAAAGTAGATGTGTTACTAGAATTACATGATAACACAAGCTCGATGTTG
AAATTTATTAAACAAAGCAGTTCATAAGGTGACTGCAAAGTACCTGTACATATATCTTAA
ATTAAAAGTGCCAATGAATTTTATGTAATCTATGAAAATAACCCAATTTAGAAATAGATA
GATGACTTAGTTGATAGTTATGACTTGCCTAAGCTGTAAAAACTTAAAGTTATCAAATAA
AAAACTTTATGTGTTGCTAAAAGTGAATAAGATGGTAAACTATATAGAGGTAAAATTGTT
CAGAAGCCAGCTAATTCTTAAGTTGACGTTGAATTTATTGATTATGGTTTGATTGAAAAA
TTGCCCACTGCTAATCTTTACTAGCTACCAACAGATTTAGCTAAATACGAGGCATAATGC
TAGCTCTGCACATTAGCATATGTAAAAGTACCATTTGGAAACCATAAACTTGCAAAAGCT
GCTAAAAAAGAATTTGAAAAGTTACTTGATAATGGATATGTTGAAGCAGAATTTGTTTAA
GCAGGAGGAAATCTAACTAGCATAATACTTACATTTGAGAATGAACCTGAGCTCGATAGA
TCTATTAATGCACTAATGATATAATCTGGATTTGCTAGAATAAACTTTAATATACCAAAT
AATCCTTTCTCAGATGAATTATTCTAAGATCTAGAGTACGATGCGACTGATTAATAAATT
GGAATTTGGGCTCTGAATAATCAAGATAGATTATCTGATGACGAAGGAGATAGTAGTGAT
AGTTATGACTATTGA


>TTHERM_00726050(protein)
MKTGLLANIISSRNIIIQKKNKPPIELKLANWQNIPLFESFSKDDEPGGLEAKQFLCQFV
RQKIKFQVDKSTQEVVIWDDEQDQSKSINDQLLSFLASNNFNKQYSKTINDYTVPISRDL
YNQITIKANQTYEFFFDEINSEGQFIAFEKNTNTLIVFQPQFVKIPVIGPQYKQFLDANL
LDNQILSKTHTICISSLEYDSKKTLIFNGLFDKISVLLKDGVASLTDMAFLSIKDQDLLE
QYDEYICQAQAENKGIWGKQTDFDSLITRIDSFLGIVREVESGIVLVIERIGEEQSQSKM
IKIQLSKIQCPQGLERGAFEAREYLRKLVIGAEVDVFLEKEQGFLQCATVIISSSQLNLN
QYLVSNGYAKIKEEFKGNFTDHKWIQTELDQKLAIQNQKGIHNKDLGIMRLKEIGVKETL
ELYQTQIKQNMNKEQYQCIVEKVLTGDRLLMRFISFSVIVKVKLFGIKCFQNDPNQPTLQ
ENYRKSIDYNYKTLMNRNVQVDVIGLHDGCLLCKVYNQKKQDQSQLLLEEGLAYFKQETD
NYDSIYEACQEKAKQEKRGIWEHEKVDVLLELHDNTSSMLKFIKQSSSQGDCKVPVHISQ
IKSANEFYVIYENNPIQKQIDDLVDSYDLPKLQKLKVIKQKTLCVAKSEQDGKLYRGKIV
QKPANSQVDVEFIDYGLIEKLPTANLYQLPTDLAKYEAQCQLCTLAYVKVPFGNHKLAKA
AKKEFEKLLDNGYVEAEFVQAGGNLTSIILTFENEPELDRSINALMIQSGFARINFNIPN
NPFSDELFQDLEYDATDQQIGIWALNNQDRLSDDEGDSSDSYDY


>TTHERM_00726050(gene)
ATGAAGACTGGACTTTTAGCAAACATTATTTCAAGCAGAAATATTATTATATAGAAAAAA
AACAAGCCTCCTATTGAATTAAAATTAGCAAATTGGTAAAATATACCTTTGTTTGAATCA
TTTTCAAAAGATGATGAACCTGGTGGCTTAGAAGCAAAGCAGTTTTTGTGTTAATTTGTA
AGATAAAAAATAAAATTTTAAGTTGATAAATCAACCCAGGAAGTAGTTATATGGGATGAC
GAATAAGACTAATCAAAGAGTATTAATGATTAGTTACTATCTTTCTTAGCTTCTAATAAC
TTTAATAAGTAGTACTCTAAGACAATCAACGATTATACTGTTCCAATTTCAAGAGATTTA
TACAATTAAATAACTATTAAAGCTAATTAAACTTATGAATTTTTTTTTGATGAAATAAAT
TCTGAAGGATAGTTCATAGCTTTTGAAAAAAATACAAATACATTGATAGTTTTTTAACCA
TAATTTGTTAAAATACCTGTTATTGGTCCTTAGTATAAGTAATTCCTAGATGCCAATTTA
CTTGATAATCAAATACTCTCAAAAACTCATACAATTTGCATTTCCTCATTAGAATATGAT
TCAAAAAAAACTCTCATTTTTAATGGTAAATAAAAACAAATGAAGTATAATTAATTTATC
AATTATTATTAAAAAATCAGGTCTATTTGATAAGATAAGTGTTCTATTAAAAGATGGTGT
AGCAAGCTTAACAGATATGGCATTCCTCTCTATCAAAGATTAGGATTTACTTGAGTAATA
TGATGAATATATATGCTAAGCATAAGCAGAAAACAAAGGTATTTGGGGTAAATAAACTGA
TTTTGATTCACTGATCACTAGAATAGATTCATTCCTTGGAATTGTAAACTACTTTATAAA
TTAAAAATATATTTAAACAAGACTAAAATGTATAAAGGTACGCGAAGTTGAATCTGGTAT
AGTTTTAGTTATAGAAAGAATAGGTGAAGAGCAAAGCTAGTCTAAGATGATAAAAATTTA
GCTTAGTAAAATTTAATGTCCATAAGGATTAGAAAGAGGTGCTTTTGAAGCGAGAGAGTA
TCTAAGAAAGCTTGTCATAGGTGCTGAAGTCGATGTTTTCTTAGAAAAAGAATAGGGATT
TTTGCAATGCGCCACTGTTATAATTTCTAGCTCTTAACTCAACTTAAATTAATATTTAGT
AAGTAACGGATATGCAAAAGTAAACAAATTTTATTATTTTATAAAAAATATTAATCAGTA
ATTATTTAGATAAAAGAAGAATTCAAAGGAAATTTTACAGACCACAAATGGATTTAGACT
GAACTTGATTAGAAGCTAGCAATTTAAAATTAAAAAGGTATACATAATAAAGATTTGGGT
ATTATGAGATTAAAAGAGATTGGAGTAAAGGAGACATTAGAATTATACTAAACTTAGATT
AAATAAAACATGAATAAGGAATAGTATTAGTGTATAGTTGAAAAAGTTCTCACTGGTGAC
AGATTACTTATGAGATTTATCAGCTTTAGTGTAATTAATTAATAAATCAAAATTTTTCTT
TTAGAATGTTTTAAAAAAATATAATTTAAATAATAATTTAGGTAATTGTCAAAGTCAAAT
TATTTGGTATTAAATGTTTCCAAAATGATCCTAATTAGCCTACTCTGTAGGAAAACTACA
GGAAATCAATTGATTATAACTACAAGACTCTTATGAATAGAAATGTCTAAGTTGACGTTA
TAGGCTTACATGATGGTTGCTTGTTGTGTAAAGTATATAATTAGAAAAAGTAAGATTAAT
CCTAACTTCTCTTAGAAGAGGGTTTAGCCTATTTCAAATAAGAAGTAAATTTTTTTAATT
TTAATGTAAATCATAATAATTCTTTGTAATTTTTGAATAAAGACTGATAATTATGATTCA
ATTTATGAAGCCTGCTAGGAAAAAGCTAAATAGGAAAAAAGAGGTATTTGGGAACATGAA
AAAGTAGATGTGTTACTAGAATTACATGATAACACAAGCTCGATGTTGAAATTTATTAAA
CAAAGCAGTTCATAAGGTGACTGCAAAGTACCTGTACATATATCTTAAATTAAAAGTGCC
AATGAATTTTATGTAATCTATGAAAATAACCCAATTTAGAAATAGATAGATGACTTAGTT
GATAGTTATGACTTGCCTAAGCTGTAAAAACTTAAAGTTATCAAATAAAAAACTTTATGT
GTTGCTAAAAGTGAATAAGATGGTAAACTATATAGAGGTAAAATTGTTCAGAAGCCAGCT
AATTCTTAAGTTGACGTTGAATTTATTGATTATGGTTTGATTGAAAAATTGCCCACTGCT
AATCTTTACTAGCTACCAACAGTAAATTTAATTTATAAAATGATTCTTTAAAGCATATTT
TCATTAAATAATAGGATTTAGCTAAATACGAGGCATAATGCTAGCTCTGCACATTAGCAT
ATGTAAAAGTACCATTTGGAAACCATAAACTTGCAAAAGCTGCTAAAAAAGAATTTGAAA
AGTTACTTGATAATGGATATGTTGAAGCAGAATTTGTTTAAGCAGGAGGAAATCTAACTA
GCATAATACTTACATTTGAGAATGAACCTGAGCTCGATAGATCTATTAATGCACTAATGA
TATAATCTGGATTTGCTAGAATAAACTTTAATATACCAAATAATCCTTTCTCAGATGAAT
TATTCTAAGATCTAGAGTACGATGCGACTGATTAATAAATTGGAATTTGGGCTCTGAATA
ATCAAGATAGATTATCTGATGACGAAGGAGATAGTAGTGATAGTTATGACTATTGA