Identifiers and Description

Gene Model Identifier

TTHERM_00600110

Standard Name

TTN1 (Tetrahymena Tudor Nuclease 1)

Aliases

PreTt22074 | 83.m00143 | 3685.m00035

Description

Tudor domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00567 ) Tudor domain
  • ( PF00565 ) Staphylococcal nuclease homologue

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00600110

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14883.19.997093137033517e-262tudor domain-containing protei
n (574 aa)
OxytrichaContig20252.0.g833.999925618735366e-62Staphylococcal nuclease homolo
gue
DictyBaseDDB_G02796593.00033207980219e-32snd1 on chromosome: 3 position
2397433 to 2400394
WormBaseWBGene000066262.999534586690157e-23locus:tsn-1 status:Confirmed
UniProt:Q19328 protein_id
:CCD69204.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17715366: Howard-Till RA, Yao MC (2007) Tudor nuclease genes and programmed DNA rearrangements in Tetrahymena thermophila. Eukaryotic cell 6(10):1795-804

Sequences

>TTHERM_00600110(coding)
ATGGCTGCCCAAAAGGATTTAAAGAAGGATAAAAAAGACATTAAGCTTCAAAATATCGAA
TTTGTTGGTATAGTTAGAGAAGTTCACTCTGGTGATTCTCTCACAATCTAATCAACTAAA
ACTAATAACATCGCCAGATTTTTCTTGACTCACGTCAGAGCTCCTAAGGTTGGAACCAAT
GATACACAAGATAAACCTTATGCTTTTGAATCTAAAGAATTCCTTCGTAAGAAACTCATA
GGTCAATAAGTAGAAGTAAAATTTGAATATGAAAAAACTGTTAAAGTCGCCAAATCTTGG
GAAGATGACAGTGAAGCTACTGAAAAACAAATGAACTTCTGTACTGTGTTCTACTAAGGC
TAAAATATTAATCTCTAATTAATCCAAGAAGGTTATGCTGAGTTCAATTTCGCCAGAACA
GAAGAAGAAAAATCATAATATCACGATGAATTGAAGACTGCTTCTGAAGAAGCTGCTAAG
AAAAAGAAGGGTCTCCACTCTACCAAAAATATCCCTCTCCACAGATTCAATGATATTTCT
CGTTTGAAAAATAAGCCTAAACTTCTTGAGCACTTCAACTCATTGAAATCAAAAGCTAGA
TTAACTGGTGTTGTTGAATTGGTCATTAGTGGTGGTATTTATAAAGTTAGAGTTAATGAA
GAACCATACTCCATTCTTGTTCTTTTAAGCGGTGTCAGATGCTTACCTCCTGATAGTAAT
ATTCCCGAATACACCACCTGGTCAAGCAAAGCATTAGATTTTGCTAAAAATAATCTACTT
TAGAGAGATGTTGAAATCCAATTAGAACGTATGGATAACAAGGGTAAGTTCCATGCTACT
GTTTTAGTGAATAAGTAAAATTATGCAAGCTAGCTCTTATCTTAAGGACTTTGCTTTACT
TTTGGTAAGGCTAAACATACTACCGAATATGAAGCTATTGAAAAGGAAGTATAAGCAGCC
AAGAAAGGATTATTCGGTTCAAATAAAATAAATATTGAAAGTTTACGTGGTTAAAATTTT
GATGTAGATTAAAAAAATGTTAAAGCTATTTCAGGTAGCATTTAAGCCAAGTTAAGCGAA
TTAATTAACACTGATGAATTCTATATCCAAGAAAATTCTCGTATTGCTGTTTTAGATAAG
ATGGAAAAGGAACTCGATGATTTTGACTTAGAAGCTTATCCTAAACTTTAATAACCTGTT
TAGCCTGGTACACCTTGTGTAGCTCTTTTCAGTGGAGACAATAATTATTATAGAGGTAAA
ATAGTTAAGAAGCGTAATGATAATAAATACGAAGTATTTTTCATTGATTACGGCTTCTAC
GATAGTGTTCATATTGATGATATGTGCAAATTACCTGAAAAATGGGCTCCTATTCAACCA
TTTGCTATCAAGCTCGGATTAGCTTACTGCGTTGGTTTACACGATAAGCATCCCTTGGCA
GTAGAAAGTGATGAAACATTCAAAGAGTTAGCTTGGGGCAAAAAAATCCACTTATCTTAC
AAATACGAAGACAACGGCGTAAAATATGTTATTGTATAAGATGCAGCTAATACTCCCTTG
AACTAAACCATCAACTTCCAACTTCTTAAAAAGGGTTTGGTTAGATTAGATGAAGGAGTA
GCCCTCCCTGAAGAACTTCAAGCTTGGTAAGAAGAATAAGATTTCGCTAAAGAAAAGAAA
ATCGGTCTTTGGGCTTATGATGAATAAGAAAATGATGATTGA


>TTHERM_00600110(protein)
MAAQKDLKKDKKDIKLQNIEFVGIVREVHSGDSLTIQSTKTNNIARFFLTHVRAPKVGTN
DTQDKPYAFESKEFLRKKLIGQQVEVKFEYEKTVKVAKSWEDDSEATEKQMNFCTVFYQG
QNINLQLIQEGYAEFNFARTEEEKSQYHDELKTASEEAAKKKKGLHSTKNIPLHRFNDIS
RLKNKPKLLEHFNSLKSKARLTGVVELVISGGIYKVRVNEEPYSILVLLSGVRCLPPDSN
IPEYTTWSSKALDFAKNNLLQRDVEIQLERMDNKGKFHATVLVNKQNYASQLLSQGLCFT
FGKAKHTTEYEAIEKEVQAAKKGLFGSNKINIESLRGQNFDVDQKNVKAISGSIQAKLSE
LINTDEFYIQENSRIAVLDKMEKELDDFDLEAYPKLQQPVQPGTPCVALFSGDNNYYRGK
IVKKRNDNKYEVFFIDYGFYDSVHIDDMCKLPEKWAPIQPFAIKLGLAYCVGLHDKHPLA
VESDETFKELAWGKKIHLSYKYEDNGVKYVIVQDAANTPLNQTINFQLLKKGLVRLDEGV
ALPEELQAWQEEQDFAKEKKIGLWAYDEQENDD


>TTHERM_00600110(gene)
ATGGCTGCCCAAAAGGATTTAAAGAAGGATAAAAAAGACATTAAGCTTCAAAATATCGAA
TTTGTTGGTATAGTTAGAGAAGTTCACTCTGGTGATTCTCTCACAATCTAATCAACTAAA
ACTAATAACATCGCCAGATTTTTCTTGACTCACGTCAGAGCTCCTAAGGTTGGAACCAAT
GATACACAAGATAAACCTTATGCTTTTGAATCTAAAGAATTCCTTCGTAAGAAACTCATA
GGTCAATAAGTAGAAGTAAAATTTGAATATGAAAAAACTGTTAAAGTCGCCAAATCTTGG
GAAGATGACAGTGAAGCTACTGAAAAACAAATGAACTTCTGTACTGTGTTCTACTAAGGC
TAAAATATTAATGTAGGATTTTTAAAATTATTTTTTTATATTTCCAACTAATAAAACATC
AAATATATTATTAAAAACACTCTAATTCATTTAAACTCTTCTAATTACTTGTTTTAATAT
CATTTTTTTAAAAATTTTAGCTCTAATTAATCCAAGAAGGTTATGCTGAGTTCAATTTCG
CCAGAACAGAAGAAGAAAAATCATAATATCACGATGAATTGAAGACTGCTTCTGAAGAAG
CTGCTAAGAAAAAGAAGGGTCTCCACTCTACCAAAAATATCCCTCTCCACAGATTCAATG
ATATTTCTCGTTTGAAAAATAAGCCTAAACTTCTTGAGCACTTCAACTCATTGAAATCGT
AAATAATTTACATAATTTTTTTTACAAATCCTCTAAATTATCGTTTAATTCTAACATTAA
AAATGGAATAACCTACCAATAGAAAAAATTAAAAAAAAAAGCATAATGCATAGTTAAGTT
TTAGTCTTCAATTATATATTAGAACAGGTTTATAAATATTTTAACAAACTATATCAGATT
CTTATAAACGTGTCACTATAGATTTAATTAAAAAAATTCCAAGATATCGTTTTTAATTAA
TTTTTTAAAAATTAACTGATAAGTGAAAATTTATTTAAGACTTTTTTATTTCAACTAACT
AAAAAATCTAGAAGATTTTTAAAAATTTTTAAAAATAAATTATGTTGTTTTAACAAAAGA
AAAAATAAAATATTATTTTTCTTAATAATTTTTTTTTTTAACTTAGAAAAGCTAGATTAA
CTGGTGTTGTTGAATTGGTCATTAGTGGTGGTATTTATAAAGTTAGAGTTAATGAAGAAC
CATACTCCATTCTTGTTCTTTTAAGCGGTGTCAGATGCTTACCTCCTGATAGTAATATTC
CCGAATACACCACCTGGTCAAGCAAAGCATTAGATTTTGCTAAAAATAATCTACTTTAGA
GAGATGTTGAAATCCAATTAGAACGTATGGATAACAAGGGTAAGTTCCATGCTACTGTTT
TAGTGAATAAGTAAAATTATGCAAGCTAGCTCTTATCTTAAGGACTTTGCTTTACTTTTG
GTAAGGCTAAACATACTACCGAATATGAAGCTATTGAAAAGGAAGTATAAGCAGCCAAGA
AAGGATTATTCGGTTCAAATAAAATAAATATTGAAAGTTTACGTGGTTAAAATTTTGATG
TAGATTAAAAAAATGTTAAAGCTATTTCAGGTAGCATTTAAGCCAAGTTAAGCGAATTAA
TTAACACTGATGAATTCTATATCCAAGAAAATTCTCGTATTGCTGTTTTAGATAAGATGG
AAAAGGAACTCGATGATTTTGACTTAGAAGCTTATCCTAAACTTTAATAACCTGTTTAGC
CTGGTACACCTTGTGTAGCTCTTTTCAGTGGAGACAATAATTATTATAGAGGTAAAATAG
TTAAGAAGCGTAATGATAATAAATACGAAGTATTTTTCATTGATTACGGCTTCTACGATA
GTGTTCATATTGATGATATGTGCAAATTACCTGAAAAATGGGCTCCTATTCAACCATTTG
CTATCAAGCTCGGATTAGCTTACTGCGTTGGTTTACACGATAAGCATCCCTTGGCAGTAG
AAAGTGATGAAACATTCAAAGAGTTAGCTTGGGGCAAAAAAATCCACTTATCTTACAAAT
ACGAAGACAACGGCGTAAAATATGTTATTGTATAAGATGCAGCTAATACTCCCTTGAACT
AAACCATCAACTTCCAACTTCTTAAAAAGGGTTTGGTTAGATTAGATGAAGGAGTAGCCC
TCCCTGAAGAACTTCAAGCTTGGTAAGAAGAATAAGATTTCGCTAAAGAAAAGAAAATCG
GTCTTTGGGCTTATGATGAATAAGAAAATGATGATTGA