Identifiers and Description

Gene Model Identifier

TTHERM_00077290

Standard Name

TTLL6E (Tubulin Tyrosine Ligase-Like)

Aliases

PreTt10075 | 5.m00426 | 3828.m01336

Description

Beta-tubulin polyglutamylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF07532 ) Bacterial Ig-like domain (group 4)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00077290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07101.19.997093137033517e-262tubulin-tyrosine ligase (575 a
a)
OxytrichaContig12092.0.g26.997046864049712e-88Tubulin-tyrosine ligase family
WormBaseWBGene000192306.002971818577897e-50locus:ttll-11 status:Partial
ly_confirmed UniProt:Q9N5L6
protein_id:CCD68978.1
Stentor CoeruleusSteCoe_12372.7487850079102147e-43
DictyBaseDDB_G02815413.9983110956465888e-22DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.000000600201742947405PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00077290(coding)
ATGGACTTATCTGTTTAACCCTGGGCAACAAATAAGAAAGATTAATTTCCTGAATTTAAT
GGATTTGGCTCTGATGACTCTGTTGATTACTCTGAATAAAATAAATAGCCATTAAAAAAC
TACAATTTATTAAATAAAGACATTGATGAAGATAGTAAAGATGACTATGATGATGAAGAT
CTAAAATCTTTAGGGCAGAATACTGAATAAAGTGTTTCTTAAGCATCATCAAGTTCGTCT
TAAAATTAGAGAAAGAAAAAGAAAATAGTTATAAAAGTTAATACTTCAAAAAGCAGATCT
GAATTAAAGTTATTGAGAATTTTAATTGATAAGAATGGATGGAAGGAAACATTTGGATAT
GAAGGTAAAATATTATGGTCTGGACTATCAATGAATGGAGAATAACTAGCTTATGATGAA
ATATGCGTTAACAGATATCCTTAAATGGAGGAACTGGCTCACAAAAAGACAACTGGATAT
TTTTTGAATTTATTTAGAGAATACTTTCCAGAGCACTTTGATTTCTTTCCTAAGACTTTT
CTCATACCTGAATAAATGGATGAGTTAAAATAAGAGTACAAGAAAAACTCTAAAAAATTA
TGTATAGCGAAACCAAGTTCTGGTTGCTAAGGTGATGGCATTAAATTAATTGAAGGAATA
AAAGATTTACCTATCTCTTCATATACACCTCATGCCAATTAATTAGTTGTTTAAGAATAT
ATTAATAATCCCATGCTAATTTAAGGCAAAAAGTTTGATCTAAGGTTGTATGTACTTATC
AGTTCTCTTGATCCTCTTATTGTTTATTTACATGATGAAGGTCTCGCTAGGTTCTGTACT
GAGCCCTATGAGAAACCATCAAAAACAAATATAAATAACTCGTATATGCACTTAACAAAT
TACTCATTGAATAAAAATAATCCAAATTTCAAGCTACCAACTGAAGAAGATTTATATTAA
GATAATGATGCCTCTAAAAGAACTATGTAGGTGACCTGGGAACAAATAGTGAAAGCTGGC
TATGATAAAGAAGAGATCTTAGGAAATATTGAAGATTTGATATGTAAATTCTTAGCTAGT
ATGCACCCATACTTGCTTTATAATTATTAATGTGTCTTTAATAAGAAGTAAGCTAAAAGA
TTTCATGTGTTAGGATTTGATATACTTCTTGATGATAAAGGAAAACCATGGTTTTTAGAA
GTAAACGCTAATCCCAGTTTTAATATTGAGCATGAAGTATATCAGCCTGATGGTAAAAAG
AAAGTAGAGTAAAGTCCTTTGGACAAGTATGTAAAGTGCAGAGTGGTTGAAGATGCCATT
TTTATTGTTAACAAAAAGATAGAAAAATAATTAGAAATAGGAAGAGATAATCACTTCAGG
GGTTTCAAATAAATAATAAGTGGAGATTTTGAAGAGTATAAAATTATGGATATGTTCTCT
GATATTCTTAAAATATATGGCAAATTAAGCGGATTTAAATTTAATTCTGCTCTTACCTCC
TCTAAATTTTCAAAATTAGCTGCATACTAAGGAATGTAAAATGATAAAGTTATCAAAAAC
GATTATGATTTAATATTCAAAAAAGTTTTATAAAATTCTTAAGAATAAGCTATGAGCTTT
TACGATTTCATAAGATCAATTGAAATTCTAGCTTAGAGATTAAACCCATAGAATTTTGAT
CCAAAAAATAAATTACCTTCTGTATCATAATTAGTTAATAATTTAATTAGATAATTATGA


>TTHERM_00077290(protein)
MDLSVQPWATNKKDQFPEFNGFGSDDSVDYSEQNKQPLKNYNLLNKDIDEDSKDDYDDED
LKSLGQNTEQSVSQASSSSSQNQRKKKKIVIKVNTSKSRSELKLLRILIDKNGWKETFGY
EGKILWSGLSMNGEQLAYDEICVNRYPQMEELAHKKTTGYFLNLFREYFPEHFDFFPKTF
LIPEQMDELKQEYKKNSKKLCIAKPSSGCQGDGIKLIEGIKDLPISSYTPHANQLVVQEY
INNPMLIQGKKFDLRLYVLISSLDPLIVYLHDEGLARFCTEPYEKPSKTNINNSYMHLTN
YSLNKNNPNFKLPTEEDLYQDNDASKRTMQVTWEQIVKAGYDKEEILGNIEDLICKFLAS
MHPYLLYNYQCVFNKKQAKRFHVLGFDILLDDKGKPWFLEVNANPSFNIEHEVYQPDGKK
KVEQSPLDKYVKCRVVEDAIFIVNKKIEKQLEIGRDNHFRGFKQIISGDFEEYKIMDMFS
DILKIYGKLSGFKFNSALTSSKFSKLAAYQGMQNDKVIKNDYDLIFKKVLQNSQEQAMSF
YDFIRSIEILAQRLNPQNFDPKNKLPSVSQLVNNLIRQL


>TTHERM_00077290(gene)
ATGGACTTATCTGTTTAACCCTGGGCAACAAATAAGAAAGATTAATTTCCTGAATTTAAT
GGATTTGGCTCTGATGACTCTGTTGATTACTCTGAATAAAATAAATAGCCATTAAAAAAC
TACAATTTATTAAATAAAGACATTGATGAAGATAGTAAAGATGACTATGATGATGAAGAT
CTAAAATCTTTAGGTAAAATAATTAATGAAAAATTTTATTAAAATATCAGAATATTTAAT
AAAATAGGGCAGAATACTGAATAAAGTGTTTCTTAAGCATCATCAAGTTCGTCTTAAAAT
TAGAGAAAGAAAAAGAAAATAGTTATAAAAGTTAATACTTCAAAAAGCAGATCTGAATTA
AAGTTATTGAGAATTTTAATTGATAAGAATGGATGGAAGGAAACATTTGGATATGAAGGT
AAAATATTATGGTCTGGACTATCAATGAATGGAGAATAACTAGCTTATGATGAAATATGC
GTTAACAGATATCCTTAAATGGAGGAACTGGCTCACAAAAAGACAACTGGATATTTTTTG
AATTTATTTAGAGAATACTTTCCAGAGCACTTTGATTTCTTTCCTAAGACTTTTCTCATA
CCTGAATAAATGGATGAGTTAAAATAAGAGTACAAGAAAAACTCTAAAAAATTATGTATA
GCGAAACCAAGTTCTGGTTGCTAAGGTGATGGCATTAAATTAATTGAAGGAATAAAAGAT
TTACCTATCTCTTCATATACACCTCATGCCAATTAATTAGTTGTTTAAGAATATATTAAT
AATCCCATGCTAATTTAAGGCAAAAAGTTTGATCTAAGGTTGTATGTACTTATCAGTTCT
CTTGATCCTCTTATTGTTTATTTACATGATGAAGGTCTCGCTAGGTTCTGTACTGAGCCC
TATGAGAAACCATCAAAAACAAATATAAATAACTCGTATATGCACTTAACAAATTACTCA
TTGAATAAAAATAATCCAAATTTCAAGGTATCAATTCATCAATCAATTTTTTGAATTTGA
TAAATAAACATTAGAAATATAACTTTTAATGCATTTTATCAATCTTCAGTCTGATTTAAT
TTATTTATTTATTGTTAAAAAAAGCTACCAACTGAAGAAGATTTATATTAAGATAATGAT
GCCTCTAAAAGAACTATGTAGGTGACCTGGGAACAAATAGTGAAAGCTGGCTATGATAAA
GAAGAGATCTTAGGAAATATTGAAGATTTGATATGTAAATTCTTAGCTAGTATGCACCCA
TACTTGCTTTATAATTATTAATGTGTCTTTAATAAGAAGTAAGCTAAAAGATTTCATGTG
TTAGGATTTGATATACTTCTTGATGATAAAGGAAAACCATGGTTTTTAGAAGTAAAATGT
TAAATATTTTTAACTAAATAATTACAAATTTATATTATAATTAATTTAGGTAAACGCTAA
TCCCAGTTTTAATATTGAGCATGAAGTATATCAGCCTGATGGTAAAAAGAAAGTAGAGTA
AAGTCCTTTGGACAAGTATGTAAAGTGCAGAGTGGTTGAAGATGCCATTTTTATTGTTAA
CAAAAAGATAGAAAAATAATTAGAAATAGGAAGAGATAATCACTTCAGGGGTTTCAAATA
AATAATAAGTGGAGATTTTGAAGAGTATAAAATTATGGATATGTTCTCTGATATTCTTAA
AATATATGGCAAATTAAGCGGATTTAAATTTAATTCTGCTCTTACCTCCTCTAAATTTTC
AAAATTAGCTGCATACTAAGGAATGTAAAATGATAAAGTTATCAAAAACGATTATGATTT
AATATTCAAAAAAGTTTTATAAAATTCTTAAGAATAAGCTATGAGCTTTTACGATTTCAT
AAGATCAATTGAAATTCTAGCTTAGAGATTAAACCCATAGAATTTTGATCCAAAAAATAA
ATTACCTTCTGTATCATAATTAGTTAATAATTTAATTAGATAATTATGA