Identifiers and Description

Gene Model Identifier

TTHERM_00985000

Standard Name

TTLL4B (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt23270 | 184.m00045

Description

Related to tubulin polyglutamylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( TIGR00590 ) proliferating cell nuclear antigen (pcna)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00985000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07233.19.997093137033517e-262tubulin-tyrosine ligase (624 a
a)
OxytrichaContig1070.1.g452.000127961544401e-120Tubulin-tyrosine ligase family
WormBaseWBGene000142321.9994274381022833e-63locus:ttll-4 Tubulin polyglu
tamylase ttll-4 status:Parti
ally_confirmed UniProt:Q0964
7 protein_id:CAA87425.3
Stentor CoeruleusSteCoe_54242.3455513385429143e-59
DictyBaseDDB_G02815413.9989916100764785e-24DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.00020003864201578029PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00985000(coding)
ATGAATAACTCTTCACCTATAAGAGTAAATAGCTACCTCTAAAGTAACAATTAAGCATGG
TAATTAGCTTAATAGATATGCCAATCGGCAACGAAGTCAAATTAATAAAATACAAGTTCA
ATAGAAAGACCACATTCATAAATTTAAGGTTAGGCTTCTTAATAAATATAGTTAAATGGT
TATAATTTTTAAGGCCACACCAGCATTATTTCGAATGGCAACTATTAGCATCAACTGCAT
CATTAAAAAGTAGCAATTAGCGAATCGCCATAAAGACCTTAATAGCAAATAATAAATAAT
CAAATTATAAAATTAGAGGCATTGGGAGTGCAAAAAGATAATCCGAATTAGATATTTTCA
TTTCATCACTAAAATGGATATTTTAAAAAGAAAAACTATTCCGCAGCAGTAAAGAGGAAT
CTTTCTTAGCAAGTATCTTAGCAATTATTTAACTGCGAATTAAAAGGCATCAATCCTTAA
CATAATATTTTCTGTGATCAAAATAAAGGATCACATTTAAGATCCAGCTCCAACCACGTT
AACCCATATATTTAGTAAAAGATAAATGGGTTTTAGTAAAGTGTTTTACAAAATAAAACT
TTGTACTATGGCTCAAATGCAAGCAATTCCCTTTTATCATCATAACCCTAAAAAATAGAT
ATATTCGCTCGTTCAACTTACTACGTTAGACCTTTATAAGAGCTAGTACAGCTCAACTCA
GGGAAAAGAATTTTGGATCCTTAAAGCTATGCAAATGCTGAAAATATAAATTAACTTGAG
TAACCTGAAAAGGCTTTAATTTAAGAAATTGAATGCAACTAGCAAGAAACTAATACAAGT
TTAAATATTGATGATTCAAGTAAACACAATTAGAGAAATCTTAGTATAAATGAAGGGAAA
ATTCAAAAAGAGATTATTGGATTACAAAATTAGTCATTTGGAATACATTGCGATAATCCA
AACAAAAGGTTGTCAGATAGTATTACAATATAAGCTCCTTTCAGTAGTCACAATTATGAT
TTCCAATAAGAGGATTATAAACTATAGAGAGTAACTCTTAACCCAGTATATAAAACAGAA
TAAAATATAGAAAGATTGGAACCTATTGAAAATGGAGATTAGTTCACTCCTTAAAGCAGC
AATTTGGAATAAAAAAAATCAAAAAAAATACAAAACTTTCCTGATTAGATGCAATTTAGT
GAAACCAAAAGGTAAATAAAACAAGCTGAACTATTTAGGATATCTTCGCCACTCAAATAC
ATAAAATCAAATGCATAGTTCAAATTAAGATCAATTTCATAGTAAGATCCAGCTTTAAAA
AATGTATTATAAGTACAGGAAAGCCCTATCAAGCAAATTTATTAAGAAAGAGAAGTTATT
GTAAAATAAAGTATCACAAATACGAATTTTGCCAACAATCCACTTATGGTTACATCTTCT
ATAGAAAAAACAATAGACTTCTAGCCAAATAATAATATTTAAGATGAAAAAGAGAGAATT
ATAAGCAAAAGCTATTCAGCTGTAAAAAAATCTCTAGCAGAGAGGACGTCAAGGTCTTAA
AACCCTCATGAAATTCTTAATCGAACTTAAAATGTGATTTAGATGTATCAAAGTTAAAAT
AGTTACAATAGCAATTACGGGAGCATAAGGAAGAGTAAGAATCATTATTCTTTTACAAAA
AAGCAGAAGGAAGAAAAAATTGAATAAATCATTTTGAAATGCACAGATAAAACATATTTT
GATCCTGCTGGTGATATGAGAAATGAGTTGCAGTAATAACAGCAAAAGGTTAGTACTTTG
AATAAGAATGATTTCAAAGTCGGAATAAACAGCGAAAAAGCTTCTCCAAAATCATAAACA
GTAATATAAAAATATGGTATTAATCAATCAGAGTAAAAGGAAGGTGATCAAGCCAAAAAA
GTGTTTGTGTTTAAAAAAAATATTAATAAAAATGAAGAAGATGACGATGATGAAGAGAAA
AATCAAAACAACAGTGATAGCGATTCATCGAAAGATTTAGATGTCGATAGTGATGAAGAT
GAAGATGAGGATGAGAATGACTTAGAAGATAGCATCGACTAAGCATTGATTAATTCAGCA
TATGAACCATCAACAGAATGCTCTGCTTCATTTTAACCTCCAGTCTTGCAACCAAATAGA
TATAACAAGCTCTTACTATTAAAAAGTGTGTATGAAAACCGTCCTTTGACCGTATTCTTT
CCCTATCCTCCTTAATGTGGAGATATCATCAGAAACTCTTCTAGAACAGTTGTAGCAACC
GATTATGAAGAAAAAAGGTTTGATATGAGGTTTAAGGTGACCACTAATAGCTTAAATAGG
TGTGTTGGACATGCATTTTAGTATGCAGGTATTAGAGAGACTGAAGATAATGACTGGAAT
ATGGTATGGAGCACTGGAAGAGATAATAGAGTAAAAAATATGATTAAATATTAAAAAATT
AACCACTTCCCATAGTATTGGAATATGGGGAGAAAGGACTGCTTGTGGAAAAATTTGTCT
AAAGTTAAAAGAAAATTTCCATAAGAATATGACTTTATTCCAAATACTTATATATTGTAA
CATTAATCAGATTGGGATAGATTTTTGGCAAAAAGAGATGATGCTGAGAAAGGAAAATTG
TGGATTATGAAGCCTAGCAACTAGGCCTAAGGAAAAAATATAAAGATGATATCAAAGAGA
AGCAAAGTATAAAGAAAGCAAGAATACATTATTTGTGAGTATGTAGCAAATCCACATTTG
ATTGATGGATTAAAATATGATCTTCGTATATATGTTTTAGTCACTTCATATGATCCTCTT
AGGATATACATTTTCGATGATGGTTTGACTCGTTTCGCGACTGAAAAATATTCAACTAAT
ACAAAAGAACTCTCAAAAAGATATGTGCATTTGACTAATTACTCACTTAATAAAAATAAT
CCTAACTTCAAGAAAAACAAGGATGCTAATGAAGATAGTGAAGGCTCGAAGTGGTCATTA
AAAGCTCTATTTAGAAAATACACAGAGATGGGAGTTAACACTGCTCAGTTGTGGGACAGA
ATAAAAGATATTGTAATTAAAACTTGTATTGCAACTGAGCCATATATGACAGATTAGTAT
GTAAAATGTGAAAATCATAGAACAAATTGTTTTGAATTGTATGGCTTTGACATATTAATC
GATGATACCCTAAAGCCTTGGTTGCTTGAAGTAAATGTGCGTCCATCTTTAAGCAGTTCT
TCTCCTTTAGACAGAAGAATAAAGCATACTTTAGTATGTGATACATTCAATTTGATAGGA
ATCTAGCCTTATGATAAAAGAAAGTTTGAAGAAGATCAAAGAAAAAAGATTCCAGGAGTA
TCTGATTAAAAAAGAGGATTTTCTAAAAACTTAAAAGATTTATCAGATTTAAATGAATTC
AACTGTTTGCAAAAGCTTTCACCAGAAGATTGGAATATGCTTTTTGAAACAGACGAAGAG
AACTATAGAACAGGACATTTCGAGAGAATTTTTCCTCCTCCTAAAGATAAAATTGATTTT
TACTTGAAGTTTTTTGAATATGAGAGATATAACAACATAATCATTCGCAGTTGGGTCAAG
TCAAGCACCAACTTTTTAGAAAAAATCTTGAAAAAAGTTTATGAATTTAATGTTTGA


>TTHERM_00985000(protein)
MNNSSPIRVNSYLQSNNQAWQLAQQICQSATKSNQQNTSSIERPHSQIQGQASQQIQLNG
YNFQGHTSIISNGNYQHQLHHQKVAISESPQRPQQQIINNQIIKLEALGVQKDNPNQIFS
FHHQNGYFKKKNYSAAVKRNLSQQVSQQLFNCELKGINPQHNIFCDQNKGSHLRSSSNHV
NPYIQQKINGFQQSVLQNKTLYYGSNASNSLLSSQPQKIDIFARSTYYVRPLQELVQLNS
GKRILDPQSYANAENINQLEQPEKALIQEIECNQQETNTSLNIDDSSKHNQRNLSINEGK
IQKEIIGLQNQSFGIHCDNPNKRLSDSITIQAPFSSHNYDFQQEDYKLQRVTLNPVYKTE
QNIERLEPIENGDQFTPQSSNLEQKKSKKIQNFPDQMQFSETKRQIKQAELFRISSPLKY
IKSNAQFKLRSISQQDPALKNVLQVQESPIKQIYQEREVIVKQSITNTNFANNPLMVTSS
IEKTIDFQPNNNIQDEKERIISKSYSAVKKSLAERTSRSQNPHEILNRTQNVIQMYQSQN
SYNSNYGSIRKSKNHYSFTKKQKEEKIEQIILKCTDKTYFDPAGDMRNELQQQQQKVSTL
NKNDFKVGINSEKASPKSQTVIQKYGINQSEQKEGDQAKKVFVFKKNINKNEEDDDDEEK
NQNNSDSDSSKDLDVDSDEDEDEDENDLEDSIDQALINSAYEPSTECSASFQPPVLQPNR
YNKLLLLKSVYENRPLTVFFPYPPQCGDIIRNSSRTVVATDYEEKRFDMRFKVTTNSLNR
CVGHAFQYAGIRETEDNDWNMVWSTGRDNRVKNMIKYQKINHFPQYWNMGRKDCLWKNLS
KVKRKFPQEYDFIPNTYILQHQSDWDRFLAKRDDAEKGKLWIMKPSNQAQGKNIKMISKR
SKVQRKQEYIICEYVANPHLIDGLKYDLRIYVLVTSYDPLRIYIFDDGLTRFATEKYSTN
TKELSKRYVHLTNYSLNKNNPNFKKNKDANEDSEGSKWSLKALFRKYTEMGVNTAQLWDR
IKDIVIKTCIATEPYMTDQYVKCENHRTNCFELYGFDILIDDTLKPWLLEVNVRPSLSSS
SPLDRRIKHTLVCDTFNLIGIQPYDKRKFEEDQRKKIPGVSDQKRGFSKNLKDLSDLNEF
NCLQKLSPEDWNMLFETDEENYRTGHFERIFPPPKDKIDFYLKFFEYERYNNIIIRSWVK
SSTNFLEKILKKVYEFNV


>TTHERM_00985000(gene)
ATGAATAACTCTTCACCTATAAGAGTAAATAGCTACCTCTAAAGTAACAATTAAGCATGG
TAATTAGCTTAATAGATATGCCAATCGGCAACGAAGTCAAATTAATAAAATACAAGTTCA
ATAGAAAGACCACATTCATAAATTTAAGGTTAGGCTTCTTAATAAATATAGTTAAATGGT
TATAATTTTTAAGGCCACACCAGCATTATTTCGAATGGCAACTATTAGCATCAACTGCAT
CATTAAAAAGTAGCAATTAGCGAATCGCCATAAAGACCTTAATAGCAAATAATAAATAAT
CAAATTATAAAATTAGAGGCATTGGGAGTGCAAAAAGATAATCCGAATTAGATATTTTCA
TTTCATCACTAAAATGGATATTTTAAAAAGAAAAACTATTCCGCAGCAGTAAAGAGGAAT
CTTTCTTAGCAAGTATCTTAGCAATTATTTAACTGCGAATTAAAAGGCATCAATCCTTAA
CATAATATTTTCTGTGATCAAAATAAAGGATCACATTTAAGATCCAGCTCCAACCACGTT
AACCCATATATTTAGTAAAAGATAAATGGGTTTTAGTAAAGTGTTTTACAAAATAAAACT
TTGTACTATGGCTCAAATGCAAGCAATTCCCTTTTATCATCATAACCCTAAAAAATAGAT
ATATTCGCTCGTTCAACTTACTACGTTAGACCTTTATAAGAGCTAGTACAGCTCAACTCA
GGGAAAAGAATTTTGGATCCTTAAAGCTATGCAAATGCTGAAAATATAAATTAACTTGAG
TAACCTGAAAAGGCTTTAATTTAAGAAATTGAATGCAACTAGCAAGAAACTAATACAAGT
TTAAATATTGATGATTCAAGTAAACACAATTAGAGAAATCTTAGTATAAATGAAGGGAAA
ATTCAAAAAGAGATTATTGGATTACAAAATTAGTCATTTGGAATACATTGCGATAATCCA
AACAAAAGGTTGTCAGATAGTATTACAATATAAGCTCCTTTCAGTAGTCACAATTATGAT
TTCCAATAAGAGGATTATAAACTATAGAGAGTAACTCTTAACCCAGTATATAAAACAGAA
TAAAATATAGAAAGATTGGAACCTATTGAAAATGGAGATTAGTTCACTCCTTAAAGCAGC
AATTTGGAATAAAAAAAATCAAAAAAAATACAAAACTTTCCTGATTAGATGCAATTTAGT
GAAACCAAAAGGTAAATAAAACAAGCTGAACTATTTAGGATATCTTCGCCACTCAAATAC
ATAAAATCAAATGCATAGTTCAAATTAAGATCAATTTCATAGTAAGATCCAGCTTTAAAA
AATGTATTATAAGTACAGGAAAGCCCTATCAAGCAAATTTATTAAGAAAGAGAGTAAAAA
TTATAAATTTTACATTAAAATTTGATTGAAAATAAAATTTTATTTTTAAAATTAAAAAAA
AAATAGAGTTATTGTAAAATAAAGTATCACAAATACGAATTTTGCCAACAATCCACTTAT
GGTTACATCTTCTATAGAAAAAACAATAGACTTCTAGCCAAATAATAATATTTAAGATGA
AAAAGAGAGAATTATAAGCAAAAGCTATTCAGCTGTAAAAAAATCTCTAGCAGAGAGGAC
GTCAAGGTCTTAAAACCCTCATGAAATTCTTAATCGAACTTAAAATGTGATTTAGATGTA
TCAAAGTTAAAATAGTTACAATAGCAATTACGGGAGCATAAGGAAGAGTAAGAATCATTA
TTCTTTTACAAAAAAGCAGAAGGAAGAAAAAATTGAATAAATCATTTTGAAATGCACAGA
TAAAACATATTTTGATCCTGCTGGTGATATGAGAAATGAGTTGCAGTAATAACAGCAAAA
GGTTAGTACTTTGAATAAGAATGATTTCAAAGTCGGAATAAACAGCGAAAAAGCTTCTCC
AAAATCATAAACAGTAATATAAAAATATGGTATTAATCAATCAGAGTAAAAGGAAGGTGA
TCAAGCCAAAAAAGTGTTTGTGTTTAAAAAAAATATTAATAAAAATGAAGAAGATGACGA
TGATGAAGAGAAAAATCAAAACAACAGTGATAGCGATTCATCGAAAGATTTAGATGTCGA
TAGTGATGAAGATGAAGATGAGGATGAGAATGACTTAGAAGATAGCATCGACTAAGCATT
GATTAATTCAGCATATGAACCATCAACAGAATGCTCTGCTTCATTTTAACCTCCAGTCTT
GCAACCAAATAGATATAACAAGCTCTTACTATTAAAAAGTGTGTATGAAAACCGTCCTTT
GACCGTATTCTTTCCCTATCCTCCTTAATGTGGAGATATCATCAGAAACTCTTCTAGAAC
AGTTGTAGCAACCGATTATGAAGAAAAAAGGTTTGATATGAGGTAAATTTTTATTTTTTA
AAGTATTTAAGCTGTAATGAAATCATTTAGTTGTTTTTCATTTTTTTTTGATGTTGTTGT
AAATTTTTGTTATATTTTTGCTATGGAAAATATTGAATAATCAAGAAATTAAAAAAAATT
TTGTTTTTTAAAGGTTTAAGGTGACCACTAATAGCTTAAATAGGTGTGTTGGACATGCAT
TTTAGTATGCAGGTATTAGAGAGACTGAAGATAATGACTGGAATATGGTATGGAGCACTG
GAAGAGATAATAGAGTAAAAAATATGATTAAATATTAAAAAATTAACCACTTCCCATAGT
ATTGGAATATGGGGAGAAAGGACTGCTTGTGGAAAAATTTGTCTAAAGTTAAAAGAAAAT
TTCCATAAGAATATGACTTTATTCCAAATACTTATATATTGTAACATTAATCAGATTGGG
ATAGATTTTTGGCAAAAAGAGATGATGCTGAGAAAGGAAAATTGTGGATTATGAAGCCTA
GCAACTAGGCCTAAGGAAAAAATATAAAGATGATATCAAAGAGAAGCAAAGTATAAAGAA
AGCAAGAATACATTATTTGTGAGTATGTAGCAAATCCACATTTGATTGATGGATTAAAAT
ATGATCTTCGTATATATGTTTTAGTCACTTCATATGATCCTCTTAGGATATACATTTTCG
ATGATGGTTTGACTCGTTTCGCGACTGAAAAATATTCAACTAATACAAAAGAACTCTCAA
AAAGATATGTGCATTTGACTAATTACTCACTTAATAAAAATAATCCTAACTTCAAGAAAA
ACAAGGATGCTAATGAAGATAGTGAAGGCTCGAAGTGGTCATTAAAAGCTCTATTTAGAA
AATACACAGAGATGGGAGTTAACACTGCTCAGTTGTGGGACAGAATAAAAGATATTGTAA
TTAAAACTTGTATTGCAACTGAGCCATATATGACAGATTAGTATGTAAAATGTGAAAATC
ATAGAACAAATTGTTTTGAATTGTATGGCTTTGACATATTAATCGATGATACCCTAAAGC
CTTGGTTGCTTGAAGTAAATGTGCGTCCATCTTTAAGCAGTTCTTCTCCTTTAGACAGAA
GAATAAAGCATACTTTAGTATGTGATACATTCAATTTGATAGGAATCTAGCCTTATGATA
AAAGAAAGTTTGAAGAAGATCAAAGAAAAAAGATTCCAGGAGTATCTGATTAAAAAAGAG
GATTTTCTAAAAACTTAAAAGATTTATCAGATTTAAATGAATTCAACTGTTTGCAAAAGC
TTTCACCAGAAGATTGGAATATGCTTTTTGAAACAGACGAAGAGAACTATAGAACAGGAC
ATTTCGAGAGAATTTTTCCTCCTCCTAAAGATAAAATTGATTTTTACTTGAAGTTTTTTG
AATATGAGAGATATAACAACATAATCATTCGCAGTTGGGTCAAGTCAAGCACCAACTTTT
TAGAAAAAATCTTGAAAAAAGTTTATGAATTTAATGTTTGA