Identifiers and Description

Gene Model Identifier

TTHERM_00758970

Standard Name

TTLL4A (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt08194 | 124.m00112 | 3821.m00527

Description

Related to tubulin polyglutamylase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00758970

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20876.19.997093137033517e-262tubulin-tyrosine ligase (1079
aa)
OxytrichaContig1070.1.g452.000319284850678e-127Tubulin-tyrosine ligase family
WormBaseWBGene000142323.9989468726312675e-65locus:ttll-4 Tubulin polyglu
tamylase ttll-4 status:Parti
ally_confirmed UniProt:Q0964
7 protein_id:CAA87425.3
Stentor CoeruleusSteCoe_54242.8946403116483003e-63
DictyBaseDDB_G02815418.99682777598231e-22DDB_G0281541 on chromosome: 3
position 4627625 to 4629265

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00758970(coding)
ATGAGAGCACAATCAATGAATATCTAATTTACTAATGAATCTAGACAGTTTTAAACGCAA
AGCAAGCAGCAAAGATATATTTAGGAAGACAAAAGCTAATAGAATATAATCAAAAAATAC
CCGAATTATGCCTATGCTTTAACTACCGAAAATTCATATGTTTAATCAACTGCAAATAAT
CGATTTGGCTAAGGACTGATAGCACTTAAAAACAAAAGTGCTAATAACAAAAGACCTTTT
TAGCCTGCTCAAAAGATGATAAGCAGTAATGGGTTTATCCATCAAGATATGCCGCAGCTT
AGCGGGTCATTTTCACCAATGATCTTTGATACAAATCAAAGGATATTATAGAAACAACAA
AAATATCTGGAATCAATGCAAGCAAATAGCAACATAATAATTAATAAAGGAAAAATATAA
CAAAATAATAGAACTATTATGCCAGCAGGTACTTTTTATAGTAGATAGAACTAAGTTCCT
TCTCCACTATAAAAGAAGTTGAGTATTTACAATGAAAATTCTCTTTAGAGCGATAACCAA
ACTCAAGGAAATGAAATGAAGAGCTAGAATTCAAATAATATCAATGAGTACACTCAAGGA
AAGAATATAGAAAATAATAACAATTATTAAAAGTTGAGAGATGTCATCCAGTATGATAAA
CTGGAAAAATTAGGAACTAGTGTGATAGATGCAAGTTTAAGAAAGCAGCAACAAGATAAA
AAAAAGCAGTTAGAGTAGTTTCCAATGAGCAGCAATACCAACAAAGGAAAAGATGGTTCT
TAGAATAATTAAATATCGATATTCACTCAAAGCAGGATTAACACAAGTAATTAAATTGAG
AATATTTACCCAGAAGAAGAAGAGTGGGACATGATTTAGCTAAGATAAATTGGATAGACA
ACAAACCAGCAAGAACAGTAGAACCAAGCTGATTAGAAAAATGAGCAAAATTTATTAAGA
TAGTCTTCTCTTGATTTAGCTGAAAGTAATAGGAAATAAGGATATAATTCAATGGTAAAA
AGCAACATTATACAATCAAATCAAAATAATTAGAGATTTTAGCTAAATTCGCCTTCACCA
GTCTAATAAAAGGCTTTTCTTTCTCCATAAAGAAACGATGATAAATTAGCAAAGTCGATT
CAGCATAATTAGTAATTAACTTAAAGTTAAAAGAGTGCTATGGTAAAGCGCTCGTACTCA
GCAGTAAAAAATTCTACATAAATTAAAAAAGATGATATCGTGAACAACAATAGTAAGAAA
ATAAATCCAAATGATTTAATGATATTGAAAATAAAGGAGCAATGCACTTATAAAAAGTAT
ATAGATCCAATCAGAATTAAGAAGGAAAAGGCTAAACTCAAGTAATAAAGCGAAGTAAAA
AACAGAAAAATTAACTTTACAAGCACTATCACAGCAGGGTACCATTTAAAATCAACTTAA
GAGGCCTAACCTAAAATGAAATCTCTTAAGGATAGCATGGTCCCTGATGACTAGCTTAGC
AATAATCTTGATATACCTGCAGCAAGATAGTATGAAGAAGAAGATGATGACGATGATGAT
TCAATGATTATGAGCAATAATGATATCTCTTTAGATTTAGACGATGACGAAGACGAAAGT
AAGTAAATTTCCTCTCCTCTTGGAGGACTTGCTAGCACATAAGATTCTATCTAAAATAAT
AACTCATAAAAATCAAAAGTTAGCTTATTAAAATCTGTTTATTAAGGTCGTCCAGCAACT
ATTTTCTTTCCATACCACAAATCTTGTTAGCAGCCTTAGCCCAGAGACACTTCTCGTGCG
ATATAAATTTCAGATTTTGAGACAAAAAAATTCAATCTCAAATACAAAATTAATGGAGAG
AATCCATACAAATGTGTTGTTAAAGCATTTGAAGAGGCTGGGTTTGAAATGACAGAGGAA
AATGATTGGAATTGTGTGTGGTCATTGCCAAAAAAAGACAGAGTGAAATTTATGAACTAG
TTTTAGAAATAAAACCACTTTCCTGGTTGCTGGAATTTAGGAAGAAAAGATTTTATGTGG
AGATGCCTGAATAGAGTTAAGAGAAAATGCCCTAAGGAAATGGATTTTGTGCCTAACACA
TATTTATTATGTAACTCAGGAGATTGGGATAGATTTTTAGCTAGGAGAGATGAAGCAAGT
AAAAATACTTTGTGGATTTTAAAACCAGCTGATTAAGCATGTGGAAGAGGAGTTAAAGTA
ATCAGCAAAACGACTAAAGTTAAAAGGAAATCTAACAGAATTATATGTGATTACATAGCT
AACCCTCATCTCATTAATGGATTGAAATACGATTTACGTTTATATGTTCTAGTAACTAGT
TATGATCCTCTTAGGATTTATCTATACGAAGAAGGATTGACCCGTTTTGCTACAGAAAAA
TATAACACAAACACCAAAGAAATAAGTAAGAGGTTTGTCCATCTAACAAACTATAGTGTT
AATAAGCATGCTAAGAAGTTTGTCAAGAATACAAATCCAGAAGCAGATGGAGAGGGATCC
AAGTGGTCTTTGACAGCTTTAAAAGCAAAATATAAACAAATGGGAATAAACGTTGACGAA
TTATTTGGAAGAATTAAGGATATAATAATAAAAACATGTATTTCTGCAGAACCATAAATG
CTAGATATAGTAGCTAAATCTCAAGAACACAGAACTAATTGCTTTGAACTTTATGGGTTT
GACATATTAATTGATTCTTCTCTCAAACCTTGGATTTTAGAGGTAAATGTCTGCCCTTCT
TTAAGCTCTTCAAGTCCTTTAGATCGTAAGATTAAGCACTCATTGTTGGTTGATGTGTTA
AATATTATTGGCATTACACCATATGATAAAAAGTAATTCACAGAAGATAAAAAGAATAAT
CTTTTTACTCGAGCATTTAACTCAATATCTTCTACAATGCTTGACTGTAATGACTCCGAG
AAGGTCTCAAACGGCAAGAAGAATTTTAGTAAAAATATAAATGATATTTAAGATCTTACC
TATGAAAATTGCCTAGAAAAGCTTTCTCCTGAGAATTGGGAAGTATTATTTGAAACAGAT
GAAGAATTATACCGCAGAGGGCATTTTGAGAGAATTTATCCCCTACCTTCTAAAGAAAAG
CTTGATTATTATTCTCAATTTTTTGACTTCTAAAGATTTAATAATGTGATGGTGCAAAAA
TGGATTACTTCAAAATAAAATTTTCTAGAAAAAATACTTAAAAAAAAATATTAAACCGTT
GTTTGA


>TTHERM_00758970(protein)
MRAQSMNIQFTNESRQFQTQSKQQRYIQEDKSQQNIIKKYPNYAYALTTENSYVQSTANN
RFGQGLIALKNKSANNKRPFQPAQKMISSNGFIHQDMPQLSGSFSPMIFDTNQRILQKQQ
KYLESMQANSNIIINKGKIQQNNRTIMPAGTFYSRQNQVPSPLQKKLSIYNENSLQSDNQ
TQGNEMKSQNSNNINEYTQGKNIENNNNYQKLRDVIQYDKLEKLGTSVIDASLRKQQQDK
KKQLEQFPMSSNTNKGKDGSQNNQISIFTQSRINTSNQIENIYPEEEEWDMIQLRQIGQT
TNQQEQQNQADQKNEQNLLRQSSLDLAESNRKQGYNSMVKSNIIQSNQNNQRFQLNSPSP
VQQKAFLSPQRNDDKLAKSIQHNQQLTQSQKSAMVKRSYSAVKNSTQIKKDDIVNNNSKK
INPNDLMILKIKEQCTYKKYIDPIRIKKEKAKLKQQSEVKNRKINFTSTITAGYHLKSTQ
EAQPKMKSLKDSMVPDDQLSNNLDIPAARQYEEEDDDDDDSMIMSNNDISLDLDDDEDES
KQISSPLGGLASTQDSIQNNNSQKSKVSLLKSVYQGRPATIFFPYHKSCQQPQPRDTSRA
IQISDFETKKFNLKYKINGENPYKCVVKAFEEAGFEMTEENDWNCVWSLPKKDRVKFMNQ
FQKQNHFPGCWNLGRKDFMWRCLNRVKRKCPKEMDFVPNTYLLCNSGDWDRFLARRDEAS
KNTLWILKPADQACGRGVKVISKTTKVKRKSNRIICDYIANPHLINGLKYDLRLYVLVTS
YDPLRIYLYEEGLTRFATEKYNTNTKEISKRFVHLTNYSVNKHAKKFVKNTNPEADGEGS
KWSLTALKAKYKQMGINVDELFGRIKDIIIKTCISAEPQMLDIVAKSQEHRTNCFELYGF
DILIDSSLKPWILEVNVCPSLSSSSPLDRKIKHSLLVDVLNIIGITPYDKKQFTEDKKNN
LFTRAFNSISSTMLDCNDSEKVSNGKKNFSKNINDIQDLTYENCLEKLSPENWEVLFETD
EELYRRGHFERIYPLPSKEKLDYYSQFFDFQRFNNVMVQKWITSKQNFLEKILKKKYQTV
V


>TTHERM_00758970(gene)
ATGAGAGCACAATCAATGAATATCTAATTTACTAATGAATCTAGACAGTTTTAAACGCAA
AGCAAGCAGCAAAGATATATTTAGGAAGACAAAAGCTAATAGAATATAATCAAAAAATAC
CCGAATTATGCCTATGCTTTAACTACCGAAAATTCATATGTTTAATCAACTGCAAATAAT
CGATTTGGCTAAGGACTGATAGCACTTAAAAACAAAAGTGCTAATAACAAAAGACCTTTT
TAGCCTGCTCAAAAGATGATAAGCAGTAATGGGTTTATCCATCAAGATATGCCGCAGCTT
AGCGGGTCATTTTCACCAATGATCTTTGATACAAATCAAAGGATATTATAGAAACAACAA
AAATATCTGGAATCAATGCAAGCAAATAGCAACATAATAATTAATAAAGGAAAAATATAA
CAAAATAATAGAACTATTATGCCAGCAGGTACTTTTTATAGTAGATAGAACTAAGTTCCT
TCTCCACTATAAAAGAAGTTGAGTATTTACAATGAAAATTCTCTTTAGAGCGATAACCAA
ACTCAAGGAAATGAAATGAAGAGCTAGAATTCAAATAATATCAATGAGTACACTCAAGGA
AAGAATATAGAAAATAATAACAATTATTAAAAGTTGAGAGATGTCATCCAGTATGATAAA
CTGGAAAAATTAGGAACTAGTGTGATAGATGCAAGTTTAAGAAAGCAGCAACAAGATAAA
AAAAAGCAGTTAGAGTAGTTTCCAATGAGCAGCAATACCAACAAAGGAAAAGATGGTTCT
TAGAATAATTAAATATCGATATTCACTCAAAGCAGGATTAACACAAGTAATTAAATTGAG
AATATTTACCCAGAAGAAGAAGAGTGGGACATGATTTAGCTAAGATAAATTGGATAGACA
ACAAACCAGCAAGAACAGTAGAACCAAGCTGATTAGAAAAATGAGCAAAATTTATTAAGA
TAGTCTTCTCTTGATTTAGCTGAAAGTAATAGGAAATAAGGTATTACTTTTATTAGCAAA
ATATTAAATTTGATCATCTTAATTTTTATTAAATATTATTAAAGGATATAATTCAATGGT
AAAAAGCAACATTATACAATCAAATCAAAATAATTAGAGATTTTAGCTAAATTCGCCTTC
ACCAGTCTAATAAAAGGCTTTTCTTTCTCCATAAAGAAACGATGATAAATTAGCAAAGTC
GATTCAGCATAATTAGTAATTAACTTAAAGTTAAAAGAGTGCTATGGTAAAGCGCTCGTA
CTCAGCAGTAAAAAATTCTACATAAATTAAAAAAGATGATATCGTGAACAACAATAGTAA
GAAAATAAATCCAAATGATTTAATGATATTGAAAATAAAGGAGCAATGCACTTATAAAAA
GTATATAGATCCAATCAGAATTAAGAAGGAAAAGGCTAAACTCAAGTAATAAAGCGAAGT
AAAAAACAGAAAAATTAACTTTACAAGCACTATCACAGCAGGGTACCATTTAAAATCAAC
TTAAGAGGCCTAACCTAAAATGAAATCTCTTAAGGATAGCATGGTCCCTGATGACTAGCT
TAGCAATAATCTTGATATACCTGCAGCAAGATAGTATGAAGAAGAAGATGATGACGATGA
TGATTCAATGATTATGAGCAATAATGATATCTCTTTAGATTTAGACGATGACGAAGACGA
AAGTAAGTAAATTTCCTCTCCTCTTGGAGGACTTGCTAGCACATAAGATTCTATCTAAAA
TAATAACTCATAAAAATCAAAAGTTAGCTTATTAAAATCTGTTTATTAAGGTCGTCCAGC
AACTATTTTCTTTCCATACCACAAATCTTGTTAGCAGCCTTAGCCCAGAGACACTTCTCG
TGCGATATAAATTTCAGATTTTGAGACAAAAAAATTCAATCTCAAATACAAAGTAAAAAA
AAATTATTTAAAATTATAAAAAAATATTTTTGCTTTTTATCAAAGCAGTAAAAATGTAAC
CAGCAAAAATAAATCTAGTTCATTCTAAATTTCTACCAAAAATTAAATACATTTTTAAAA
TTATTTAAATGTATTTTATCATGCATGAAAAATAATAAGTCTTTATTTAAATAAATAGAT
TAATGGAGAGAATCCATACAAATGTGTTGTTAAAGCATTTGAAGAGGCTGGGTTTGAAAT
GACAGAGGAAAATGATTGGAATTGTGTGTGGTCATTGCCAAAAAAAGACAGAGTGAAATT
TATGAACTAGTTTTAGAAATAAAACCACTTTCCTGGTTGCTGGAATTTAGGAAGAAAAGA
TTTTATGTGGAGATGCCTGAATAGAGTTAAGAGAAAATGCCCTAAGGAAATGGATTTTGT
GCCTAACACATATTTATTATGTAACTCAGGAGATTGGGATAGATTTTTAGCTAGGAGAGA
TGAAGCAAGTAAAAATACTTTGTGGATTTTAAAACCAGCTGATTAAGCATGTGGAAGAGG
AGTTAAAGTAATCAGCAAAACGACTAAAGTTAAAAGGAAATCTAACAGAATTATATGTGA
TTACATAGCTAACCCTCATCTCATTAATGGATTGAAATACGATTTACGTTTATATGTTCT
AGTAACTAGTTATGATCCTCTTAGGATTTATCTATACGAAGAAGGATTGACCCGTTTTGC
TACAGAAAAATATAACACAAACACCAAAGAAATAAGTAAGAGGTTTGTCCATCTAACAAA
CTATAGTGTTAATAAGCATGCTAAGAAGTTTGTCAAGAATACAAATCCAGAAGCAGATGG
AGAGGGATCCAAGTGGTCTTTGACAGCTTTAAAAGCAAAATATAAACAAATGGGAATAAA
CGTTGACGAATTATTTGGAAGAATTAAGGATATAATAATAAAAACATGTATTTCTGCAGA
ACCATAAATGCTAGATATAGTAGCTAAATCTCAAGAACACAGAACTAATTGCTTTGAACT
TTATGGGTTTGACATATTAATTGATTCTTCTCTCAAACCTTGGATTTTAGAGGTAAATGT
CTGCCCTTCTTTAAGCTCTTCAAGTCCTTTAGATCGTAAGATTAAGCACTCATTGTTGGT
TGATGTGTTAAATATTATTGGCATTACACCATATGATAAAAAGTAATTCACAGAAGATAA
AAAGAATAATCTTTTTACTCGAGCATTTAACTCAATATCTTCTACAATGCTTGACTGTAA
TGACTCCGAGAAGGTCTCAAACGGCAAGAAGAATTTTAGTAAAAATATAAATGATATTTA
AGATCTTACCTATGAAAATTGCCTAGAAAAGCTTTCTCCTGAGAATTGGGAAGTATTATT
TGAAACAGATGAAGAATTATACCGCAGAGGGCATTTTGAGAGAATTTATCCCCTACCTTC
TAAAGAAAAGCTTGATTATTATTCTCAATTTTTTGACTTCTAAAGATTTAATAATGTGAT
GGTGCAAAAATGGATTACTTCAAAATAAAATTTTCTAGAAAAAATACTTAAAAAAAAATA
TTAAACCGTTGTTTGA