Identifiers and Description

Gene Model Identifier

TTHERM_00378750

Standard Name

TTLL3E (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt10329 | 40.m00214

Description

Related to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF07813 ) LTXXQ motif
  • ( PF05672 ) E-MAP-115 family
  • ( PF00922 ) vesiculovirus phosphoprotein
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF06658 ) Protein of unknown function (DUF1168)
  • ( PF06394 ) Pepsin inhibitor-3-like repeated domain
  • ( PF09026 ) Centromere protein B dimerisation domain
  • ( TIGR02863 ) small, acid-soluble spore protein, SspJ

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00378750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00099.19.997093137033517e-262tubulin-tyrosine ligase (1051
aa)
OxytrichaContig8461.0.g601.999126889527329e-167Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_55111.5007857627073948e-41
DictyBaseDDB_G02815412.0008113830639685e-30DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
WormBaseWBGene000441879.99967697349061e-30locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
SGDYBR094W0.000000600201742947405PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00378750(coding)
ATGAGTTCTTTAGATGAAGGTTTAAAATAAATGAGCCAATAGGAATATAGAAACGAAGAA
TAAAATCAGGAAGGCAATTAGGAGGATTTAAACAATCAAAATGATCACAATTTAAATAAT
AATGAATTAGATAGCCTGTCTTCTCCTCCATCAGACAATTATAATGAAGAAGAATTTGAG
TAAGAAGATGATATTAAACCTGACATAAAAATATATTAAAATGCATCACAAAATAACATA
TCGTAGACATAAAGGATAAGTTAAACTTAACTACCATAGCAGTAAGGAGGAGGGGGAAAA
AGGAATTCGTCTCTTTTGCAAAAAGAACACTATCATCAAAAAAATTAAGAGATCATATAA
AAACTGATGGAGAAAAAGAAAAAAGAATAAGAAGAAAAAGAAAAAAAAGAATTGAAATTA
AAAAAAAGAGAAGATAAATTGCGTAAGCGCATGCTTGAAGAAGCAGCAAAGATTAGAGAG
CAAAAGGAAGTAAATTTAGAATCATAAACTGAATAAAGCGATCACTCAAACGTCACAAAA
TCAAAAAAACTCAAATTCAAGAGTGTATAAGATATTTACTAACTTGTAGTCATATAAGGA
AAATATCAAAGAGAGTAATTAACAGATAAGTAGCAGTAAGAACTCAACGAATTTGAAAGT
AGGCTGAACGAAGAAAAAACAACGATAATTAAGATGCAATAAGTTTACAGATCACGTCAA
ATTACTTTTTTAGAGGAGTTAAAGAAAAAATAGGAGAAAAAAAAGCAAGAAGAGGAATAA
CAGAAACTAAAGCAGGAGAAAATACAAACCAAATTAAGGGAATAATATGAAAATGTGAAT
TCTAATCTCTATGCTGAAACTGAGTTATTCAAGTAAAAAAAGCAAGAAATTACCAAGGTC
AGCACTTAGAAATAGCTTGTAAGAGCATCATCTGCAGAAGGAGATAAAGAGAAAGATGAT
AAGAAGGATATCGCCAAAAAAATATAGTAGAAGAATCAAGAGTATATTGAAAAGTTGAAA
GAAAAAAAGAGATAAGAGATTGCTAAAGAGGAAGAGGAAAAGAAGAAAAAGGAGCAACTC
AAAGAAAAAATGAAAGATTTTGTCCTTGTCAATATCAAAAAAGACATTGAAAATGGAGTT
TTTTTTGTTGATGTTCCAGAAAAAAAACCTAAAAAAGAGAAGAAAAAGAATGAATCTAAA
GAAGATAACATTTAAATTACTTCTCCTAAGTTAAATTCTACCAAGTCTTTATCTTCATAA
ATTACAAGAAAAACAAACGATGCTAAAAAAGTAGAAAAACTCCCAAAAATTAAAGATTCA
AATAAGGAGAATCATTCCAAAGAAAGAAATGAAGATAATGAAGAAGGGGATGATGGAGAA
TATGAATGTGACGAAGGTGATGAAGGTGCAAGCGATGGAGAAGATGAAGATGATGGAAAT
GGTAGTGCCATTAAAAGAAAGCTTAGAAAATATCCCTTTATCACTGATTTAGAGTTATGG
AAAAAAAAACAAAGATTGCCTGCTGACATTAAAGTGTTCATTGTTACTGGAGGCTATCAC
GACATATCAAAAGCTTTGAAAAAAAGAGGTTGGATTGCAAACCCTGATACAAAAAGTCCT
TGCTACAATTTCAGATGGAGCTTACAAACTAAGGACATAGATTATGAAAATTTAAAGGAT
TTCTAAATAGTTAATCACTTTTAAAAGAGTGCATGTATCACAACCAAAGTTGGGTTATGC
AAAAGTCTAAGAAATCTAGTTTGGCATGAAAATGTAGATATCGATACATTCTATCCTAGA
TGTTTTGATTTAAACGATACTGAAGATTTCGAAAATTTTGTCGAAGAGTTTAAATCCTCT
AAGGCTGAGAGCATCCTAAAGAGATACATGAGAATGTACTTTGAAAAAGATCCAGATATT
GAAAAAATAAAAAAGTAGGCTGTAATTGCATTTAATGTTTGTGAAAGAAAAATGAAAGAA
TTAGATGAAATTATAGATGATCCAAACTCAATATAGCTGATAACTAAAAAAGAGTGGAAT
ATACTCTCAGCTGATGAACTTACTGAAGAAAAGCTCGCTTAAAAGAAATATGAGTAATGG
CTAGAAAGGATTGAAGGTAAAAATAAATAAAAACCTAAAAAGAAAAAGAAGAAATCAAAG
AAGGATAAACAATAAGGAGATACAGAGAAGAAAGAAGAGGAAGAAGGAGAGGCTGAAGAT
GAAGAAGAGGATGAAGAAGATGAGGAAGAAGAAGAAAAGCAAATGGATGAATTCACTTTG
AAGGTTCATCAAATCCTTAAAAGGTATAAAGTAAAGTATCCTTAAGATTGCTTGACAGGT
GAAGATAATGTCTGGATTATAAAACCTGCTGGACTTTCAAGAGGCAGAGGAATTACGTGC
TACAATAATTTAGTTGAAATTCTTGATCATGTTAAGTCTAAGGAGTCATAATGGGTAATT
CAGAAATATATAGAAAATCCCTTGATCATAAAAAAAAGAAAGTTTGATATTAGAGTTTGG
ATTCTTGTCACTGATTGGAATCCATTGACTATTTGGCACTATACAGACTGTTATGTGAGA
TTCAGTGTTGATGATTATGATACTGAAAACCTCCAAAATAAATTTACTCACTTAACAAAT
AACATGGTTTCTAAGCTTAAGTAAAGGGATGAAAAAGACGATATAACAGAGTTAGGAAGC
ATGTATTTCAAAGAGAATTTTATCAACTATTTAAAAGAAAAAGAAGGATATGATGTATTT
ACAGATAAGATTGAGCCTTAGATTGTGAGGGCAATTATTATGTCTTTGAAGAGTGTTTAG
GACAATATAGAAAATCGTAAAAATAGTATTGAAATGTATGGGTATGATTTCATGGTTGAT
GATTTGTACAATACTTGGCTCATTGAAATTAACTCTTCTCCCTCTATGGAATACTCAACA
CCAGTGACTGAAAGGTTAGTCAAAGCTGTTTCTGAAGATATAGTAAAGGTGGTTATAGAT
TATGGAATGGAAAAGAGTAAAAAAGCAAGGAAAAATATAGAAACAGGGGCTTTTAAGAGA
ATATATAAAGGCAAATATGTTGAAGAAAAAACAAATGTAGTCGGTCTAAATTTAATATGT
GAAGGTGTAGCATTAAAAAAAGGAAAAAAGAATTCAAACGTTGCAAAAGTTAATAATCTA
AAACCTAATTTCTCATGA


>TTHERM_00378750(protein)
MSSLDEGLKQMSQQEYRNEEQNQEGNQEDLNNQNDHNLNNNELDSLSSPPSDNYNEEEFE
QEDDIKPDIKIYQNASQNNISQTQRISQTQLPQQQGGGGKRNSSLLQKEHYHQKNQEIIQ
KLMEKKKKEQEEKEKKELKLKKREDKLRKRMLEEAAKIREQKEVNLESQTEQSDHSNVTK
SKKLKFKSVQDIYQLVVIQGKYQREQLTDKQQQELNEFESRLNEEKTTIIKMQQVYRSRQ
ITFLEELKKKQEKKKQEEEQQKLKQEKIQTKLREQYENVNSNLYAETELFKQKKQEITKV
STQKQLVRASSAEGDKEKDDKKDIAKKIQQKNQEYIEKLKEKKRQEIAKEEEEKKKKEQL
KEKMKDFVLVNIKKDIENGVFFVDVPEKKPKKEKKKNESKEDNIQITSPKLNSTKSLSSQ
ITRKTNDAKKVEKLPKIKDSNKENHSKERNEDNEEGDDGEYECDEGDEGASDGEDEDDGN
GSAIKRKLRKYPFITDLELWKKKQRLPADIKVFIVTGGYHDISKALKKRGWIANPDTKSP
CYNFRWSLQTKDIDYENLKDFQIVNHFQKSACITTKVGLCKSLRNLVWHENVDIDTFYPR
CFDLNDTEDFENFVEEFKSSKAESILKRYMRMYFEKDPDIEKIKKQAVIAFNVCERKMKE
LDEIIDDPNSIQLITKKEWNILSADELTEEKLAQKKYEQWLERIEGKNKQKPKKKKKKSK
KDKQQGDTEKKEEEEGEAEDEEEDEEDEEEEEKQMDEFTLKVHQILKRYKVKYPQDCLTG
EDNVWIIKPAGLSRGRGITCYNNLVEILDHVKSKESQWVIQKYIENPLIIKKRKFDIRVW
ILVTDWNPLTIWHYTDCYVRFSVDDYDTENLQNKFTHLTNNMVSKLKQRDEKDDITELGS
MYFKENFINYLKEKEGYDVFTDKIEPQIVRAIIMSLKSVQDNIENRKNSIEMYGYDFMVD
DLYNTWLIEINSSPSMEYSTPVTERLVKAVSEDIVKVVIDYGMEKSKKARKNIETGAFKR
IYKGKYVEEKTNVVGLNLICEGVALKKGKKNSNVAKVNNLKPNFS


>TTHERM_00378750(gene)
ACGAATTGCTTGGTAAATTTTGCTTTTTTCAAAATTGCTTTGAAATTTTAAAGATTTGTT
TAAATTTTTAGAAAATATATGTTTTAAATTGTGATTGTTTTTTTACACTTTGTATAGAAA
ATATAAGAAGTTTTGTAAAAAAAATGAGTTCTTTAGATGAAGGTTTAAAATAAATGAGCC
AATAGGAATATAGAAACGAAGAATAAAATCAGGAAGGCAATTAGGAGGATTTAAACAATC
AAAATGATCACAATTTAAATAATAATGAATTAGATAGCCTGTCTTCTCCTCCATCAGACA
ATTATAATGAAGAAGAATTTGAGTAAGAAGATGATATTAAACCTGACATAAAAATATATT
AAAATGCATCACAAAATAACATATCGTAGACATAAAGGATAAGTTAAACTTAACTACCAT
AGCAGTAAGGAGGAGGGGGAAAAAGGAATTCGTCTCTTTTGCAAAAAGAACACTATCATC
AAAAAAATTAAGTATTAATTTAATTGATTTGATCATTTTAACATAGAAAAGAACGATGCT
CATCTTATAAATAGGAGATCATATAAAAACTGATGGAGAAAAAGAAAAAAGAATAAGAAG
AAAAAGAAAAAAAAGAATTGAAATTAAAAAAAAGAGAAGATAAATTGCGTAAGCGCATGC
TTGAAGAAGCAGCAAAGATTAGAGAGCAAAAGGAAGTAAATTTAGAATCATAAACTGAAT
AAAGCGATCACTCAAACGTCACAAAATCAAAAAAACTCAAATTCAAGAGTGTATAAGATA
TTTACTAACTTGTAGTCATATAAGGAAAATATCAAAGAGAGTAATTAACAGATAAGTAGC
AGTAAGAACTCAACGAATTTGAAAGTAGGCTGAACGAAGAAAAAACAACGATAATTAAGA
TGCAATAAGTTTACAGATCACGTCAAATTACTTTTTTAGAGGAGTTAAAGAAAAAATAGG
AGAAAAAAAAGCAAGAAGAGGAATAACAGAAACTAAAGCAGGAGAAAATACAAACCAAAT
TAAGGGAATAATATGAAAATGTGAATTCTAATCTCTATGCTGAAACTGAGTTATTCAAGT
AAAAAAAGCAAGAAATTACCAAGGTCAGCACTTAGAAATAGCTTGTAAGAGCATCATCTG
CAGAAGGTAAATGAATTATACATTTCAGCTAATTTTTATTTATTTATTTGTTATTTATTT
TGAATAATATATAACAATAATTTATGTTTAAGAGAATAAATAAATAAATAATTATACTGT
TACAACCTTATGTTTTGATAAATTACTAATCATTTGTATTTTCTATATTGAATAGGAGAT
AAAGAGAAAGATGATAAGAAGGATATCGCCAAAAAAATATAGTAGAAGAATCAAGAGTAT
ATTGAAAAGTTGAAAGAAAAAAAGAGATAAGAGATTGCTAAAGAGGAAGAGGAAAAGAAG
AAAAAGGAGCAACTCAAAGAAAAAATGAAAGATTTTGTCCTTGTCAATATCAAAAAAGAC
ATTGAAAATGGAGTTTTTTTTGTTGATGTTCCAGAAAAAAAACCTAAAAAAGAGAAGAAA
AAGAATGAATGTATTTTTTTACTTTAACTATTCTAATAATATTAAAATTTTGGAAAATAA
ATTATAGCTAAAGAAGATAACATTTAAATTACTTCTCCTAAGTTAAATTCTACCAAGTCT
TTATCTTCATAAATTACAAGAAAAACAAACGATGCTAAAAAAGTAGAAAAACTCCCAAAA
ATTAAAGATTCAAATAAGGAGAATCATTCCAAAGAAAGAAATGAAGATAATGAAGAAGGG
GATGATGGAGAATATGAATGTGACGAAGGTGATGAAGGTGCAAGCGATGGAGAAGATGAA
GATGATGGAAATGGTAGTGCCATTAAAAGAAAGCTTAGAAAATATCCCTTTATCACTGAT
TTAGAGTTATGGAAAAAAAAACAAAGATTGCCTGCTGACATTAAAGTAAATTTACTTTTT
CATTTATCTCTCTTAAAATTTAATTTTCAATAAAAATAGGTGTTCATTGTTACTGGAGGC
TATCACGACATATCAAAAGCTTTGAAAAAAAGAGGTTGGATTGCAAACCCTGATACAAAA
AGTCCTTGCTACAATTTCAGATGGAGCTTACAAACTAAGGACATAGATTATGAAAATTTA
AAGGATTTCTAAATAGTTAATCACTTTTAAAAGAGTGCATGTATCACAACCAAAGTTGGG
TTATGCAAAAGTCTAAGAAATCTAGTTTGGCATGAAAATGTAGATATCGATACATTCTAT
CCTAGATGTTTTGATTTAAACGATACTGAAGATTTCGAAAATTTTGTCGAAGAGTTTAAA
TCCTCTAAGGTAAATAAATAAATAAATAAAAAAAATTATTTTTTCTTAATAATTTAAACA
AACTATAACAGGCTGAGAGCATCCTAAAGAGATACATGAGAATGTACTTTGAAAAAGATC
CAGATATTGAAAAAATAAAAAAGTAGGCTGTAATTGCATTTAATGTTTGTGAAAGAAAAA
TGAAAGAATTAGATGAAATTATAGATGATCCAGTAATAAATAGTTATATTTTTTTATAAG
TGTTTGTTATAATTTTTTTTAAAGAACTCAATATAGCTGATAACTAAAAAAGAGTGGAAT
ATACTCTCAGCTGATGAACTTACTGAAGAAAAGCTCGCTTAAAAGAAATATGAGTAATGG
CTAGAAAGGATTGAAGGTAAAAATAAATAAAAACCTAAAAAGAAAAAGAAGAAATCAAAG
AAGGATAAACAATAAGGAGATACAGAGAAGAAAGAAGAGGAAGAAGGAGAGGCTGAAGAT
GAAGAAGAGGATGAAGAAGATGAGGAAGAAGAAGAAAAGCAAATGGATGAATTCACTTTG
AAGGTTCATCAAATCCTTAAAAGGTATAAAGTAAAGTATCCTTAAGATTGCTTGACAGGT
GAAGATAATGTCTGGATTATAAAACCTGCTGGACTTTCAAGAGGCAGAGGAATTACGTGC
TACAATAATTTAGTTGAAATTCTTGATCATGTTAAGTCTAAGGAGTCATAATGGGTAATT
CAGAAATATATAGAAAATCCCTTGATCATAAAAAAAAGAAAGGTAAATAAATAAATTGAT
TTTTAGAAATTAATAAAAAAATTATTTCTTAATAATATTTTTTAGTTTGATATTAGAGTT
TGGATTCTTGTCACTGATTGGAATCCATTGACTATTTGGCACTATACAGACTGTTATGTG
AGATTCAGTGTTGATGATTATGATACTGAAAACCTCCAAAATAAATTTACTCACTTAACA
AATAACATGGTTTCTAAGCTTAAGTAAAGGGATGAAAAAGACGATATAACAGAGTTAGGA
AGCATGTATTTCAAAGAGAATTTTATCAACTATTTAAAAGTATTAATTTTATTTATTTAT
TTTAGACTTTACTTTAATCTACTTTTAAGGAAAAAGAAGGATATGATGTATTTACAGATA
AGATTGAGCCTTAGATTGTGAGGGCAATTATTATGTCTTTGAAGAGTGTTTAGGACAATA
TAGAAAATCGTAAAAATAGTATTGAAATGTATGGGTATGATTTCATGGTTGATGATTTGT
ACAATACTTGGCTCATTGAAATTAACTCTTCTCCCTCTATGGAATACTCAACAGTAATAA
ATAAATATTTAGTTGATTCATAAATTTGAATAATTATTTTTTAATTATTTTAGCCAGTGA
CTGAAAGGTTAGTCAAAGCTGTTTCTGAAGATATAGTAAAGGTGGTTATAGATTATGGAA
TGGAAAAGAGTAAAAAAGCAAGGAAAAATATAGAAACAGGGGCTTTTAAGAGAATATATA
AAGGCAAATATGTTGAAGAAAAAACAAATGTAGTCGGTCTAAATTTAATATGTGAAGGTG
TAGCATTAAAAAAAGGAAAAAAGAATTCAAACGTTGCAAAAGTTAATAATCTAAAACCTA
ATTTCTCATGAAAATAATCAGTTAATAAACTGATCATTAACTTATGAAGAATGAGAATAT
AAGGCATTCATTCTTTGAAATTAAAGTACTGAACCCAATGCAAAAATAAAAATAAATTTA
ATTAATTAAAAAGTATAATTTAAAAATATATATCCTAATAATTTTATTAATATATTATTG
TGTTTGTTAAGTTTCTCCTTTCAGATTTTTTGATAACAATCAAGATCATCTAATT