Identifiers and Description

Gene Model Identifier

TTHERM_00193570

Standard Name

TTLL2 (Related to tubulin polyglutamylase)

Aliases

PreTt06640 | 16.m00296

Description

Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF04003 ) Dip2/Utp12 Family
  • ( PF01290 ) Thymosin beta-4 family
  • ( PF07780 ) Spb1 C-terminal domain
  • ( PF02344 ) Myc leucine zipper domain
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF06513 ) Repeat of unknown function (DUF1103)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00193570

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_03637.19.997093137033517e-262tubulin-tyrosine ligase (1703
aa)
OxytrichaContig2119.0.g903.0002313851495736e-155Tubulin-tyrosine ligase family
WormBaseWBGene000083313.998479955315009e-46locus:ttll-5 status:Partiall
y_confirmed UniProt:O17720
protein_id:CAB02862.3
Stentor CoeruleusSteCoe_256156.47023492564546e-26
SGDYBR094W0.000000009996807949091551PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00193570(coding)
ATGGCTATCAAGCTTCCTGAAATTCCTATCATAGAAGATATTTATGATTTTGACACAATT
ACCCTAAGAGAGGTAACAGAAAAGGTGCAATTAACTCTTTAAAAAATTGATAATATAGAA
TAAAAAGAATAAGCTTAAATTTTATGGTTGAAGAAAGCAAAGCGATATTTAGAATTAGCA
TTATAGGAAATAGAAGAGAGAAAAGCTATTGAGAATTTTGGTAATTACTGTGTTTCGAAT
AATGACTCCATTTTAATGTCAAATGTAGAAGATACAAGTGGCATATCTGATTCCTCAGTA
AAAAAAATGGAATAATAGAATAATTAAGCACAAACCAGTAATAAGTAAAATTAAAAAAAT
TCCTTTGGAAATATTGATGAATGGATAAAGCTGCATTAGTAGATTTCATAACAATCTGCA
TCAAATTTATAAAATTAATAAGAAAAAAAATCTGCTACGAATTAGCAGAAACACTATTCT
GTCCCATACTAAATCAAGGAAAGTGAAGAGGAAGATGATGAAAATTATTAATCTACACCT
CAGCAAATAAATAAGCATGATAACACAGATTAAAGGAAATTTAATTCTCAACACAAATTA
TAAGATGATGAGGAGGAGGATGATGATGAGAATGCTTACGAAAATTAGAACAACTATGAC
GAAGAGGAAAATTTACACTCTGCGTCAGTAATGAAAAATCAAAAGTCAGCTTATGAAAAA
AACCAAAAAAACTATAAACAAGCGAATAATGACTTTTGTAATAATAGCATAATAAGTGGA
AAATCAGGAGGAAGCCATACATCCTCATAGCTCAAATATATAGCTCATCATAAAAGATTG
AAAACTAAATCAAAATAAGAAGAGATGCAAGAATTTATTCGTTAAACTCTAGAAAAAACA
AAAATAACTTAAAGTTCGTATGTTGGTGGATCATCTGGTTATACTTAATAGTATTTTAAT
AAAACTAGCACTTAAACTTAGGGTGAAGAATCCAGTGATGGAACTGAGATTTCAATCCCT
AAGAAAAAAACTAAATCCGTTAGTAGTGCTTAAGTAACAGCTACATCGCTACCTAAAAGG
TAAAGTATAAGTGATAAGGTTTAGACCTCTAATGAATATGCTGGAGTTTAGAGTAGAATT
AAAATGGATCTTGAACAATAAAAGTTAAAAAAACTTGAAACTCCTTATTTTACAACAGGA
AAAGCTTCGTATCCTAAATATAAACCTCCAAAGCAAAAGAAAGTAGATCCTGAAGAAGAA
AAAAAGAATAGGACTAAAAATTTTTTAAAGAAGTCTTTGCCCTCAGTCAGCTTACCTCCT
ATAAATTAAAAAAAACCTGCAATTAAATCAGGTAGTGCTGACAATTCTAGTGTGAATGGG
TCAGAAAGAGAAAATAAAAAGAGCAATCCATTTATCAGTAGAGCTGCTTCAGTGACTACC
TCAGCATCTACTGACAACCTTAGTGAAAAAATATCAGCTTAAAATGTGGATTTATCTAAT
ATAATAGGAGATGATCATTCTCAAGATTCTAATAAACACTATAAAAAACCTTTTTCAGAT
AAAAGCATTAGCAACGATTTCACCTAAAATCAATAATAAGGAGAAATTATATAGGAAGAA
ATAAATGAGAACAATAATGAAAGCGATGCTGAGTAACACCAAAAAATTATACCTGGATAA
CCAAGAAAAATAACTAAGGGAGAGTTATTTAGAATTAAAAGTACAAGAAGTGCAACTTCC
GATAAAAGCAGTAACAGTTAAATGGGTGAATCTGTAACTCCATCTAAATTTGATTTTTCA
GACAATCCATAGCAATTTATAGAGGAAGATATAAGTAATTAAGAATCTAATAATGAACTA
AGAGATAAATTAATTAAAACAAAAAGCAGATCTTCTCTTCACTCTCTCAAGAATACTGTG
ATTGTTGAAGATTAAACCAAAAACTAAATCGTAGAAAAGAATGACTAAGAAATAAACAGA
AAAGTCGATGATTAAAATTTAAAAATAAATAATAATGATTAAAATATTTATATAAGTAAT
GAGGATTAGCATAATTCAAATGATTTAGCCATAATTAACAGCAACAAAAATAATAATAAT
AATAATGACAAATAAAAACAAAATACACATCCTATTATACCATCAATTATACCACCTGAA
AAAGAAGGAATTCTTTCAATTAAAACTATTTTAAATTAAGATGAAAATTAAAATAACAAT
GTTATATAAAGAAGAGAGGCTGATGAAAATCCAACTGATTCTGAAGATGATCTTAACGAA
GAAGAGAGGTTGCTTTTATACAATAAGTAGCCATCTGATGATAATGTTCAAATAAAAAAT
GAAGAAAAATCAAAAGAACATTAAACCTCTGATGGAGAGTTTTTAGAGAGCCACTTAGAA
GACTAGGAAAAGGAACTTTTACAAAATAATAGTAGAAAAGGATCAATAAAAGAATTAAGT
TAAAAAAATTTCGATTAAAAGTAACTGATAAATCACAATAAACATTCTAAGTCTAAAACT
GACATATATTAATAAGACGAAAAAGAAGATAAATAAGAAGAAGAGGAGGATTACTAAGGT
GAAGACTAATTAGATGAAGACGAATAACTTTTATTAAATAATTAAAACTAAGAGAAAGGT
AAAGAATATGAACTAATTGAAAAATATGAAAAAGATAGCAAATAAATTGTTATTAATGCT
AAAAAAATATTAGAAAACAGAGGGATTAACGAGTAGCTAAAAAATAGAATGGAAAAACTT
CTCAATAACTTTTAGCAAAATGAAAAATAAGTTTAAGAAATTGAATAAAGCTTTAATGAA
AGTGAAGAATAGCATAAAAAGCATTCAGAAGAAGTTAAGAAAAATAAGAACTAGATATTT
GGAGTACCCTCTAAAAAAAAACCTGAGTCACCTTTAACAACGGGAAATGCTAATAAAATT
GCATCTAAAAAAGAGAATGAATATAATAAAGGAGTAAACACTTAGGATCCTAAAGGAAAG
AAAGAAGTTAAAACCCAAGGAAATGATCAGGCTAATCAGCAAAAGAGCAAGGAAGAAAGG
ACTGGAAATGATATAACAAATAATACTGAAAAAAAATAAAATTAACTGAAAGGTAATCCA
AATGCAGTTTCAAAATCAGGAGAAAAAAAATTAAAAAGCAAAGAGGAGCTTGAATTAGAA
GCTTTATAAGTTGAGTAAGAATAATTCCTAAAAGAGCAAAAGCAAATAATGAAGAAAAAA
GCAACTGCTACAGCTGCACCTAAACCTCCAAGTATGACTAGCAAATTATTAATGAAAATG
ATGAAAGAAATTAGTGATGATAATTTAATTGATTATACATAAACTATACCTTCTTTCTTT
CACTTATTTTCAGGATATTACAATTAGATATGGAGTCAGAATAATCCCATGATGGGCGGA
AATGTAGGAAGCTCTATTAATATAAATATTGCTGGCGGTGGAGGAGTTAATTTTTGCTTG
ATAGATGCCATGAGGGATATCTATTCATTATTTTAATAGCATGTCGAAAAGGTAGATAAT
GCTGATAAAGGATTACTTAGATATAAATAAGTAGTTACACCTCTTGAGGTGCTTCCTTCA
GAAGTATACTATGTTAATGATCCATAAAAGGTTATAGTTTACTAAAACAGAGTTGATATA
GACATTAAGAAGTTTATAGAAAGACAAATTATTTTTACCTAGCGTATGAATGGAGAGAAT
TTTGCAGGTCACTTGCTGCCACATGAAGAGTTTTACTATCGTGTTGTTAAAAGCAAACCT
GAAGTTTATGATATTATCACTCGTTCTTTTATGAGAAAGAAAGATTGGTTTGAATTACCT
CATGGTTTACAACTAAGAACATCATGGAATCTTTTGTGGACTTGGAGCAAGCCATAGATA
GATTTTAATAAATTGCTACTTTTTTAAAAAGTAAATCATTTTCCATTCAACAAAAACCTA
GTTCGTAAAGATCTACTAAAAAAGAACTTTGAACGTATTACTAAATTAGGCTAAAAAGCA
GCTCAAGCATTCAACATTTTACCTCTAACGTTTGTGCTTCCAAAAGAATATTGTAATTTT
TCTGAAAGATTTTATGAAGAAATGTTGCGAGAAGGCGAAAATAATATTTGGATTATGAAA
CCTGTTGGTAAATCATAGGGCAGAGGTATTTCATTAGTAAATGACATAGCATAAGTAGTA
TATGCAGAGCCAGTTGTAGTATAAAAATATATGAAAGACCCACTGCTTCTTGATGGTTAT
AAATTTGATATGCGTATTTATGCATTAATTACTCATATGAAACCATTAGAAGCTTTTGTA
TATAAAGAGGGTTTTGCTCGTCTTAGTACTGAAAAATATTAATTAAATGCTCAAACAATA
AAAAATAATTAGATTCATTTAACTAACTTCAGTATACAAAAGCATCATTATGATCCTGCC
TCAAATAACAATTTTATTGGTGGAACAAAAATATCTCTGAAAATGCTTCAAGAGAAATTC
CGCTAGAAAGGTATAGATTGGGATAAAATATGGATTTAAGTGTAGGAAATTATAGTAAAA
AGTGTTTTAGCATGCCAAGCAGACATTCCTAATAATCCTAACTGTTTTGAAATATTTGGA
TATGATATAATTATTGACTCATCCTTAAAATGTTGCTTATTAGAAATTAATTCCTCCCCA
TCTCTTGCAAGAGATTTTATAATAGATGATTTAATAAAATAGTAAATGATTGATGATGCA
ATAGATTTAGTTTCACCAGTTTAATTTGATCGACTTCGCCTTTTGGAAGTATTAGATCGC
CGTATTCGTGAAGAGTAAGGTAATAAAAGTAATATAAACACAACTAATAACTCAAAGTTG
CAACTTAATAGAGACCTTAATTATATTCTCCGTGGACAAAAGCTGAGACAATTTGGTGAA
ACACCATCTTACTTAGGTCAATGGTAAAAAGTGGCTCCAACAGAAATGTCAGATAAATAT
TTAAAAATAATTTAAAGTTATAAATTACCTTCAGTGAGATAAAATACAGCAAATGCAGCT
AATAATAATAATACTATAGATTGA


>TTHERM_00193570(protein)
MAIKLPEIPIIEDIYDFDTITLREVTEKVQLTLQKIDNIEQKEQAQILWLKKAKRYLELA
LQEIEERKAIENFGNYCVSNNDSILMSNVEDTSGISDSSVKKMEQQNNQAQTSNKQNQKN
SFGNIDEWIKLHQQISQQSASNLQNQQEKKSATNQQKHYSVPYQIKESEEEDDENYQSTP
QQINKHDNTDQRKFNSQHKLQDDEEEDDDENAYENQNNYDEEENLHSASVMKNQKSAYEK
NQKNYKQANNDFCNNSIISGKSGGSHTSSQLKYIAHHKRLKTKSKQEEMQEFIRQTLEKT
KITQSSYVGGSSGYTQQYFNKTSTQTQGEESSDGTEISIPKKKTKSVSSAQVTATSLPKR
QSISDKVQTSNEYAGVQSRIKMDLEQQKLKKLETPYFTTGKASYPKYKPPKQKKVDPEEE
KKNRTKNFLKKSLPSVSLPPINQKKPAIKSGSADNSSVNGSERENKKSNPFISRAASVTT
SASTDNLSEKISAQNVDLSNIIGDDHSQDSNKHYKKPFSDKSISNDFTQNQQQGEIIQEE
INENNNESDAEQHQKIIPGQPRKITKGELFRIKSTRSATSDKSSNSQMGESVTPSKFDFS
DNPQQFIEEDISNQESNNELRDKLIKTKSRSSLHSLKNTVIVEDQTKNQIVEKNDQEINR
KVDDQNLKINNNDQNIYISNEDQHNSNDLAIINSNKNNNNNNDKQKQNTHPIIPSIIPPE
KEGILSIKTILNQDENQNNNVIQRREADENPTDSEDDLNEEERLLLYNKQPSDDNVQIKN
EEKSKEHQTSDGEFLESHLEDQEKELLQNNSRKGSIKELSQKNFDQKQLINHNKHSKSKT
DIYQQDEKEDKQEEEEDYQGEDQLDEDEQLLLNNQNQEKGKEYELIEKYEKDSKQIVINA
KKILENRGINEQLKNRMEKLLNNFQQNEKQVQEIEQSFNESEEQHKKHSEEVKKNKNQIF
GVPSKKKPESPLTTGNANKIASKKENEYNKGVNTQDPKGKKEVKTQGNDQANQQKSKEER
TGNDITNNTEKKQNQLKGNPNAVSKSGEKKLKSKEELELEALQVEQEQFLKEQKQIMKKK
ATATAAPKPPSMTSKLLMKMMKEISDDNLIDYTQTIPSFFHLFSGYYNQIWSQNNPMMGG
NVGSSININIAGGGGVNFCLIDAMRDIYSLFQQHVEKVDNADKGLLRYKQVVTPLEVLPS
EVYYVNDPQKVIVYQNRVDIDIKKFIERQIIFTQRMNGENFAGHLLPHEEFYYRVVKSKP
EVYDIITRSFMRKKDWFELPHGLQLRTSWNLLWTWSKPQIDFNKLLLFQKVNHFPFNKNL
VRKDLLKKNFERITKLGQKAAQAFNILPLTFVLPKEYCNFSERFYEEMLREGENNIWIMK
PVGKSQGRGISLVNDIAQVVYAEPVVVQKYMKDPLLLDGYKFDMRIYALITHMKPLEAFV
YKEGFARLSTEKYQLNAQTIKNNQIHLTNFSIQKHHYDPASNNNFIGGTKISLKMLQEKF
RQKGIDWDKIWIQVQEIIVKSVLACQADIPNNPNCFEIFGYDIIIDSSLKCCLLEINSSP
SLARDFIIDDLIKQQMIDDAIDLVSPVQFDRLRLLEVLDRRIREEQGNKSNINTTNNSKL
QLNRDLNYILRGQKLRQFGETPSYLGQWQKVAPTEMSDKYLKIIQSYKLPSVRQNTANAA
NNNNTID


>TTHERM_00193570(gene)
ATGGCTATCAAGCTTCCTGAAATTCCTATCATAGAAGATATTTATGATTTTGACACAATT
ACCCTAAGAGAGGTAACAGAAAAGGTGCAATTAACTCTTTAAAAAATTGATAATATAGAA
TAAAAAGAATAAGCTTAAATTTTATGGTTGAAGAAAGCAAAGCGATATTTAGAATTAGCA
TTATAGGAAATAGAAGAGAGAAAAGCTATTGAGAATTTTGGTAATTACTGTGTTTCGAAT
AATGACTCCATTTTAATGTCAAATGTAGAAGATACAAGTGGCATATCTGATTCCTCAGTA
AAAAAAATGGAATAATAGAATAATTAAGCACAAACCAGTAATAAGTAAAATTAAAAAAAT
TCCTTTGGAAATATTGATGAATGGATAAAGCTGCATTAGTAGATTTCATAACAATCTGCA
TCAAATTTATAAAATTAATAAGAAAAAAAATCTGCTACGAATTAGCAGAAACACTATTCT
GTCCCATACTAAATCAAGGAAAGTGAAGAGGAAGATGATGAAAATTATTAATCTACACCT
CAGCAAATAAATAAGCATGATAACACAGATTAAAGGAAATTTAATTCTCAACACAAATTA
TAAGATGATGAGGAGGAGGATGATGATGAGAATGCTTACGAAAATTAGAACAACTATGAC
GAAGAGGAAAATTTACACTCTGCGTCAGTAATGAAAAATCAAAAGTCAGCTTATGAAAAA
AACCAAAAAAACTATAAACAAGCGAATAATGACTTTTGTAATAATAGCATAATAAGTGGA
AAATCAGGAGGAAGCCATACATCCTCATAGCTCAAATATATAGCTCATCATAAAAGATTG
AAAACTAAATCAAAATAAGAAGAGATGCAAGAATTTATTCGTTAAACTCTAGAAAAAACA
AAAATAACTTAAAGTTCGTATGTTGGTGGATCATCTGGTTATACTTAATAGTATTTTAAT
AAAACTAGCACTTAAACTTAGGGTGAAGAATCCAGTGATGGAACTGAGATTTCAATCCCT
AAGAAAAAAACTAAATCCGTTAGTAGTGCTTAAGTAACAGCTACATCGCTACCTAAAAGG
TAAAGTATAAGTGATAAGGTTTAGACCTCTAATGAATATGCTGGAGTTTAGAGTAGAATT
AAAATGGATCTTGAACAATAAAAGTTAAAAAAACTTGAAACTCCTTATTTTACAACAGGA
AAAGCTTCGTATCCTAAATATAAACCTCCAAAGCAAAAGAAAGTAGATCCTGAAGAAGAA
AAAAAGAATAGGACTAAAAATTTTTTAAAGAAGTCTTTGCCCTCAGTCAGCTTACCTCCT
ATAAATTAAAAAAAACCTGCAATTAAATCAGGTAGTGCTGACAATTCTAGTGTGAATGGG
TCAGAAAGAGAAAATAAAAAGAGCAATCCATTTATCAGTAGAGCTGCTTCAGTGACTACC
TCAGCATCTACTGACAACCTTAGTGAAAAAATATCAGCTTAAAATGTGGATTTATCTAAT
ATAATAGGAGATGATCATTCTCAAGATTCTAATAAACACTATAAAAAACCTTTTTCAGAT
AAAAGCATTAGCAACGATTTCACCTAAAATCAATAATAAGGAGAAATTATATAGGAAGAA
ATAAATGAGAACAATAATGAAAGCGATGCTGAGTAACACCAAAAAATTATACCTGGATAA
CCAAGAAAAATAACTAAGGGAGAGTTATTTAGAATTAAAAGTACAAGAAGTGCAACTTCC
GATAAAAGCAGTAACAGTTAAATGGGTGAATCTGTAACTCCATCTAAATTTGATTTTTCA
GACAATCCATAGCAATTTATAGAGGAAGATATAAGTAATTAAGAATCTAATAATGAACTA
AGAGATAAATTAATTAAAACAAAAAGCAGATCTTCTCTTCACTCTCTCAAGAATACTGTG
ATTGTTGAAGATTAAACCAAAAACTAAATCGTAGAAAAGAATGACTAAGAAATAAACAGA
AAAGTCGATGATTAAAATTTAAAAATAAATAATAATGATTAAAATATTTATATAAGTAAT
GAGGATTAGCATAATTCAAATGATTTAGCCATAATTAACAGCAACAAAAATAATAATAAT
AATAATGACAAATAAAAACAAAATACACATCCTATTATACCATCAATTATACCACCTGAA
AAAGAAGGAATTCTTTCAATTAAAACTATTTTAAATTAAGATGAAAATTAAAATAACAAT
GTTATATAAAGAAGAGAGGCTGATGAAAATCCAACTGATTCTGAAGATGATCTTAACGAA
GAAGAGAGGTTGCTTTTATACAATAAGTAGCCATCTGATGATAATGTTCAAATAAAAAAT
GAAGAAAAATCAAAAGAACATTAAACCTCTGATGGAGAGTTTTTAGAGAGCCACTTAGAA
GACTAGGAAAAGGAACTTTTACAAAATAATAGTAGAAAAGGATCAATAAAAGAATTAAGT
TAAAAAAATTTCGATTAAAAGTAACTGATAAATCACAATAAACATTCTAAGTCTAAAACT
GACATATATTAATAAGACGAAAAAGAAGATAAATAAGAAGAAGAGGAGGATTACTAAGGT
GAAGACTAATTAGATGAAGACGAATAACTTTTATTAAATAATTAAAACTAAGAGAAAGGT
AAAGAATATGAACTAATTGAAAAATATGAAAAAGATAGCAAATAAATTGTTATTAATGCT
AAAAAAATATTAGAAAACAGAGGGATTAACGAGTAGCTAAAAAATAGAATGGAAAAACTT
CTCAATAACTTTTAGCAAAATGAAAAATAAGTTTAAGAAATTGAATAAAGCTTTAATGAA
AGTGAAGAATAGCATAAAAAGCATTCAGAAGAAGTTAAGAAAAATAAGAACTAGATATTT
GGAGTACCCTCTAAAAAAAAACCTGAGTCACCTTTAACAACGGGAAATGCTAATAAAATT
GCATCTAAAAAAGAGAATGAATATAATAAAGGAGTAAACACTTAGGATCCTAAAGGAAAG
AAAGAAGTTAAAACCCAAGGAAATGATCAGGCTAATCAGCAAAAGAGCAAGGAAGAAAGG
ACTGGAAATGATATAACAAATAATACTGAAAAAAAATAAAATTAACTGAAAGGTAATCCA
AATGCAGTTTCAAAATCAGGAGAAAAAAAATTAAAAAGCAAAGAGGAGCTTGAATTAGAA
GCTTTATAAGTTGAGTAAGAATAATTCCTAAAAGAGCAAAAGCAAATAATGAAGAAAAAA
GCAACTGCTACAGCTGCACCTAAACCTCCAAGTATGACTAGCAAATTATTAATGAAAATG
ATGAAAGAAATTAGTGATGATAATTTAATTGATTATACATAAACTATACCTTCTTTCTTT
CACTTATTTTCAGGATATTACAATTAGATATGGAGTCAGAATAATCCCATGATGGGCGGA
AATGTAGGAAGCTCTATTAATATAAATATTGCTGGCGGTGGAGGAGTTAATTTTTGCTTG
ATAGATGCCATGAGGGATATCTATTCATTATTTTAATAGCATGTCGAAAAGGTAGATAAT
GCTGATAAAGGATTACTTAGATATAAATAAGTAGTTACACCTCTTGAGGTGCTTCCTTCA
GAAGTATACTATGTTAATGATCCATAAAAGGTTATAGTTTACTAAAACAGAGTTGATATA
GACATTAAGAAGTTTATAGAAAGACAAATTATTTTTACCTAGCGTATGAATGGAGAGAAT
TTTGCAGGTCACTTGCTGCCACATGAAGAGTTTTACTATCGTGTTGTTAAAAGCAAACCT
GAAGTTTATGATATTATCACTCGTTCTTTTATGAGAAAGAAAGATTGGTTTGAATTACCT
CATGGTTTACAACTAAGAACATCATGGAATCTTTTGTGGACTTGGAGCAAGCCATAGATA
GATTTTAATAAATTGCTACTTTTTTAAAAAGTAAATCATTTTCCATTCAACAAAAACCTA
GTTCGTAAAGATCTACTAAAAAAGAACTTTGAACGTATTACTAAATTAGGCTAAAAAGCA
GCTCAAGCATTCAACATTTTACCTCTAACGTTTGTGCTTCCAAAAGAATATTGTAATTTT
TCTGAAAGATTTTATGAAGAAATGTTGCGAGAAGGCGAAAATAATATTTGGATTATGAAA
CCTGTTGGTAAATCATAGGGCAGAGGTATTTCATTAGTAAATGACATAGCATAAGTAGTA
TATGCAGAGCCAGTTGTAGTATAAAAATATATGAAAGACCCACTGCTTCTTGATGGTTAT
AAATTTGATATGCGTATTTATGCATTAATTACTCATATGAAACCATTAGAAGCTTTTGTA
TATAAAGAGGGTTTTGCTCGTCTTAGTACTGAAAAATATTAATTAAATGCTCAAACAATA
AAAAATAATTAGATTCATTTAACTAACTTCAGTATACAAAAGCATCATTATGATCCTGCC
TCAAATAACAATTTTATTGGTGGAACAAAAATATCTCTGAAAATGCTTCAAGAGAAATTC
CGCTAGAAAGGTATAGATTGGGATAAAATATGGATTTAAGTGTAGGAAATTATAGTAAAA
AGTGTTTTAGCATGCCAAGCAGACATTCCTAATAATCCTAACTGTTTTGAAATATTTGGA
TATGATATAATTATTGACTCATCCTTAAAATGTTGCTTATTAGAAATTAATTCCTCCCCA
TCTCTTGCAAGAGATTTTATAATAGATGATTTAATAAAATAGTAAATGATTGATGATGCA
ATAGATTTAGTTTCACCAGTTTAATTTGATCGACTTCGCCTTTTGGAAGTATTAGATCGC
CGTATTCGTGAAGAGTAAGGTAATAAAAGTAATATAAACACAACTAATAACTCAAAGTTG
CAACTTAATAGAGACCTTAATTATATTCTCCGTGGACAAAAGCTGAGACAATTTGGTGAA
ACACCATCTTACTTAGGTCAATGGTAAAAAGTGGCTCCAACAGAAATGTCAGATAAATAT
TTAAAAATAATTTAAAGTTATAAATTACCTTCAGTGAGATAAAATACAGCAAATGCAGCT
AATAATAATAATACTATAGATTGA