Identifiers and Description

Gene Model Identifier

TTHERM_00238750

Standard Name

TTLL14T (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt18814 | 20.m00278 | 3706.m00044

Description

Similar to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF09146 ) BmKK2 toxic
  • ( PF00008 ) EGF-like domain
  • ( TIGR01612 ) rhoptry protein
  • ( PF00451 ) Scorpion short toxin
  • ( PF01754 ) A20-like zinc finger
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF00757 ) Furin-like cysteine rich region
  • ( PF01500 ) Keratin, high sulfur B2 protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF04021 ) Protein of unknown function (DUF361)
  • ( PF00228 ) Bowman-Birk serine protease inhibitor family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00238750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07921.19.997093137033517e-262tubulin-tyrosine ligase (2167
aa)
OxytrichaContig22013.0.g141.9997677415930956e-65Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_166981.2995814250075031e-24
WormBaseWBGene000441874.999245259173412e-21locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815410.00000000000020009182674645818DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.000000000500206551404915PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00238750(coding)
ATGTTAAATAAACCTCTAAATTAAACATTAAAAGGATAATCAAATGGTAATGGTGTATAA
AATAGCATTTCAAAGATAATTGATGAATAATATTATAGTAACTCAGTACAATATGATATT
TCTGATTAAACGATAATTATTTAAAACGAGTCTAATGGTTAATTTAAAGAAAAAAACCGG
GCATTTTCTCCTGATTTGATAAAAAATGCTTTAAACGAGCAACTTTTAAAAATTAATAAC
TCAAAAAATAAAATTGATGACTAAAATGAAGCATACAAAGAATCAAATTTAAAAAATTTT
AGAGATAAAATGTTTTCAGTTGATTTAAATTCAATATTAAGAGAAACTCCCAAATGTAAC
TCTTCAAGACCAACTCCTTAAAAAAGCAGGCTATTAAGTTTATCGAAAAAGAGATAAAGT
GATTGTGAATCATTAACTCTAATTAATGTAGAATAATTATGTCTTAAAGAAAAGCTCAAA
AGAACGTATCAGATTTAATAAGACTAAAATGATCAGTAATTTAGGAATACAATAGGGATA
TCTCCATTTAAAACTACTTTTAGAGTTAAAAAGCAATATAAAACTAAATGTCCTGCAGAA
ATATTTAATAAAAGAATCAACCAACTCGAAGAAAAACTTAATGATAATTCATTTTCTTAT
TCGACTTAATTTTAAACTGAACAAAATACTTAAATTGGAAAAATAAATAATTTGAATCAA
ACAACTGAGGAGTAATAAAACAGCTTTTCTGAAGATTTTTTTCCTGTAAATGAAAAGGGA
AAGGAAATGAAAAGTTTAGAAATAAACTATTTAGTTAAAAAGCTAAATGAATAAAAGAAT
TCAACAAAAGTTGATTTTAAATTCCCTCAATTTAAATCAGAAACGAACAAGGCTAATACA
GATTAAAACAAGGTATTTAATAAAGTACTTCTAAAAGCAAATCTGAATAAAAGCTAAGAA
TATGATAGTAATAAATCTAAAAGTTTGGATTAGAAATCTAATACAGGATTGAAATACTCA
CAATGTTAGCCAATCTTATAAGTAGATAACTCCTAGTAATAGCAATCTAAAAAGAAGATT
AAAAAGCACTCAAAATTGATTAATCATTAGCTAAATAATTTTAATTCTTCTTCTCCAGTT
AAAAAGAACAGTATATAACTTGTTAAGGTAAACAACTCATTAGTTATATAACAGAGTCCC
ATATTTATGAATCCTGAAATTAAATTAAATTATTCAATATGCTATGGAAATAACTCTAAT
CTTATAAGAAGAGTTATGTAAAAAAGGTAACCTTTGTGGAACGAGATAAGTACTACACTT
TCTAATTACTAATTTAGGTGGTAACCTACTTCTCAAGGCTTCAATTTTCATTCATCTTAA
GAAAATCCAAAATATCCTAAAGTATTTAATCATTTTGAGTTTCATAAGCATTTATCAGAT
AAAAGTTTCTTATTATTTAATGTTGTTAATTATTGTGTAAAAAATAATATTGACGCTTTT
GAATTCATGCCAATTAGTTTTTATTTTGATTTCAATGAAGAAAAATTTGAGAAAGACCTT
CAGAAGTTTTCTTATTTGTTTGAGAGACTCAATTTTTACTCTAAAAGTCAGGAAAGCAAG
AAAAATATTCCTTCAGACTAAGAAATAATACAAATTTGTTTAAATGAGTTTAAAGATTCA
ATAGAAATTTCTAAAGCAATTCATGAACAAAAAGCTTAAAATAGATTATAATTTTAACCT
AAAACTACTATAGATATTGTTGAAAAACAAATATTAAAATAATTCTTGTAAATTTAGGAA
ACAAATTTTTTGAAAAGTAGAATGAGTGAAAATCTGCTATCAAATTTTAACATTTGGGTT
TTAAAGCCAGTTAACCTGAACAGAGGTAACGGTATAACAATAGTTTAATCTCTCAAAGAA
ATTAATAGTGCAATAAGTGTAGGCTTTGAGTAACAAAGTCATGTAGTTTCAGATTTGTAA
CCATCTTAAAAGCTGTATTTTAATAGCTCTGTGCCAGTTAGTCCTGCCAAAAAGAATAAA
ATCAAACCTTTATTTTACTAGTTCATTTTATAAAAGTACATTGAAAGACCTCTACTTTTT
CATGGTAGGAAGTTTGATATTAGAATATGGGTACTTGTAACTTATACAAATAAATTTCAA
TATTATTAATCAAAAGAAGGATGGGTGAGAACTAGTGGATATGGTTTTGATTTAAAAACA
AGTAACAAATACATTCATTTGACCAATAATGCTATTTAAAAAAATTCAGAACAATATGGA
TAATTTGAGAATGGAAATTCAATCAATTATGCAACTCTTAAAAAATATATTAATTCAATG
AACAGCAAAGAAAGTGAAGGAGTATGGGATGGAATCTAGCAAAAAATAAGAAATATAATT
AAGATTACACTTTAAGCTACTTCAGATAAAATTAATATTTTTAATAGAGAAAAATAATTT
GAGCTTTTTGGCTACGATTTTATGATTGACTAGTCTTTTAAACCATGGCTTATAGAAGTG
AACACTAATCCATGCATTGAAGAATCTAGTGAAGTATTAAAACAAATTCTACCTAGGCTG
ATAGATGACATGTTAAGATTGACTATTGACTAGTTTTTTAGCAAGCAAACAAACCAAAAT
TAAAGTTTTTTTCCCTTAATAGGCTACTCTAATGAGGATTCTATTTTTGAGTAATTTGAA
ATATGA


>TTHERM_00238750(protein)
MLNKPLNQTLKGQSNGNGVQNSISKIIDEQYYSNSVQYDISDQTIIIQNESNGQFKEKNR
AFSPDLIKNALNEQLLKINNSKNKIDDQNEAYKESNLKNFRDKMFSVDLNSILRETPKCN
SSRPTPQKSRLLSLSKKRQSDCESLTLINVEQLCLKEKLKRTYQIQQDQNDQQFRNTIGI
SPFKTTFRVKKQYKTKCPAEIFNKRINQLEEKLNDNSFSYSTQFQTEQNTQIGKINNLNQ
TTEEQQNSFSEDFFPVNEKGKEMKSLEINYLVKKLNEQKNSTKVDFKFPQFKSETNKANT
DQNKVFNKVLLKANLNKSQEYDSNKSKSLDQKSNTGLKYSQCQPILQVDNSQQQQSKKKI
KKHSKLINHQLNNFNSSSPVKKNSIQLVKVNNSLVIQQSPIFMNPEIKLNYSICYGNNSN
LIRRVMQKRQPLWNEISTTLSNYQFRWQPTSQGFNFHSSQENPKYPKVFNHFEFHKHLSD
KSFLLFNVVNYCVKNNIDAFEFMPISFYFDFNEEKFEKDLQKFSYLFERLNFYSKSQESK
KNIPSDQEIIQICLNEFKDSIEISKAIHEQKAQNRLQFQPKTTIDIVEKQILKQFLQIQE
TNFLKSRMSENLLSNFNIWVLKPVNLNRGNGITIVQSLKEINSAISVGFEQQSHVVSDLQ
PSQKLYFNSSVPVSPAKKNKIKPLFYQFILQKYIERPLLFHGRKFDIRIWVLVTYTNKFQ
YYQSKEGWVRTSGYGFDLKTSNKYIHLTNNAIQKNSEQYGQFENGNSINYATLKKYINSM
NSKESEGVWDGIQQKIRNIIKITLQATSDKINIFNREKQFELFGYDFMIDQSFKPWLIEV
NTNPCIEESSEVLKQILPRLIDDMLRLTIDQFFSKQTNQNQSFFPLIGYSNEDSIFEQFE
I


>TTHERM_00238750(gene)
ATGTTAAATAAACCTCTAAATTAAACATTAAAAGGATAATCAAATGGTAATGGTGTATAA
AATAGCATTTCAAAGATAATTGATGAATAATATTATAGTAACTCAGTACAATATGATATT
TCTGATTAAACGATAATTATTTAAAACGAGTCTAATGGTTAATTTAAAGAAAAAAACCGG
GCATTTTCTCCTGATTTGATAAAAAATGCTTTAAACGAGCAACTTTTAAAAATTAATAAC
TCAAAAAATAAAATTGATGACTAAAATGAAGCATACAAAGAATCAAATTTAAAAAATTTT
AGAGATAAAATGTTTTCAGTTGATTTAAATTCAATATTAAGAGAAACTCCCAAATGTAAC
TCTTCAAGACCAACTCCTTAAAAAAGCAGGCTATTAAGTTTATCGAAAAAGAGATAAAGT
GATTGTGAATCATTAACTCTAATTAATGTAGAATAATTATGTCTTAAAGAAAAGCTCAAA
AGAACGTATCAGATTTAATAAGACTAAAATGGTTTTATTTTTAAGATTTCATAAAATAAA
TATTTACTAAATTAATTTATAATTAAGAATTAGATCAGTAATTTAGGAATACAATAGGGA
TATCTCCATTTAAAACTACTTTTAGAGTTAAAAAGCAATATAAAACTAAATGTCCTGCAG
AAATATTTAATAAAAGAATCAACCAACTCGAAGAAAAACTTAATGATAATTCATTTTCTT
ATTCGACTTAATTTTAAAGTATTATGAAATTATTTTATATGAAATTAAATATTTTAATCA
ATATAAATTAATATTTTTTAAATGAAAATTTATTTGATATATTGATAACAATAAATTCTT
TTTATTTTAAAATGTGAAAATTAAGCTGAACAAAATACTTAAATTGGAAAAATAAATAAT
TTGAATCAAACAACTGAGGAGTAATAAAACAGCTTTTCTGAAGATTTTTTTCCTGTAAAT
GAAAAGGGAAAGGAAATGAAAAGTTTAGAAATAAACTATTTAGTTAAAAAGCTAAATGAA
TAAAAGAATTCAACAAAAGTTGATTTTAAATTCCCTCAATTTAAATCAGAAACGAACAAG
GCTAATACAGATTAAAACAAGGTATTTAATAAAGTACTTCTAAAAGCAAATCTGAATAAA
AGCTAAGAATATGATGTATTTTACTTAATAAATAAACTGTTTATTTATATAATTTATTTA
GAGTAATAAATCTAAAAGTTTGGATTAGAAATCTAATACAGGATTGAAATACTCACAATG
TTAGCCAATCTTATAAGTAGATAACTCCTAGTAATAGCAATCTAAAAAGAAGATTAAAAA
GCACTCAAAATTGATTAATCATTAGCTAAATAATTTTAATTCTTCTTCTCCAGTTAAAAA
GAACAGTATATAACTTGTTAAGGTAAACAACTCATTAGTTATATAACAGAGTCCCATATT
TATGAATCCTGAAATTAAATTAAATTATTCAATATGCTATGGAAATAACTCTAATCTTAT
AAGAAGAGTTATGTAAAAAAGGTAACCTTTGTGGAACGAGATAAGTACTACACTTTCTAA
TTACTAATTTAGGTGGTAACCTACTTCTCAAGGCTTCAATTTTCATTCATCTTAAGAAAA
TCCAAAATATCCTAAAGTATTTAATCATTTTGAGTTTCATAAGCATTTATCAGATAAAGT
AAATTTATTCATTTTTCTTTTAAAAATGTTTTTTTTAAATATGAATATTTATTTAAAATA
AAATTCTTAATTTTAATAGAATAATTAATTTCTGTTAAAAATTCTTTTTGAAAATAGATT
TAAACTCTTTTCTTTTATTGATTATAAATTTAATTTAACTTTTGAGTTTTTATAATTTAA
TTATTATTTAAAGAAAATCGAAATTTCATAAAATTTATTTTAAAAAAAGAGTTTCTTATT
ATTTAATGTTGTTAATTATTGTGTAAAAAATAATATTGACGCTTTTGAATTCATGCCAAT
TAGTTTTTATTTTGATTTCAATGAAGAAAAATTTGAGAAAGACCTTCAGAAGTTTTCTTA
TTTGTTTGAGAGACTCAATTTTTACTCTAAAAGTCAGGAAAGCAAGAAAAATATTCCTTC
AGACTAAGAAATAATACAAATTTGTTTAAATGAGTTTAAAGATTCAATAGAAATTTCTAA
AGCAATTCATGAACAAAAAGCTTAAAATAGATTATAATTTTAACCTAAAACTACTATAGA
TATTGTTGAAAAACAAATATTAAAATAATTCTTGTAAATTTAGGAAACAAATTTTTTGAA
AAGTAGAATGAGTGAAAATCTGCTATCAAATTTTAACATTTGGGTTTTAAAGCCAGTTAA
CCTGAACAGAGGTAACGGTATAACAATAGTTTAATCTCTCAAAGAAATTAATAGTGCAAT
AAGTGTAGGCTTTGAGTAACAAAGTCATGTAGTTTCAGATTTGTAACCATCTTAAAAGCT
GTATTTTAATAGCTCTGTGCCAGTTAGTCCTGCCAAAAAGAATAAAATCAAACCTTTATT
TTACTAGTTCATTTTATAAAAGTACATTGAAAGACCTCTACTTTTTCATGGTAGGAAGTT
TGATATTAGAATATGGGTACTTGTAACTTATACAAATAAATTTCAATATTATTAATCAAA
GTAAATATTTAATAATTTAATCTTTTATGTATATTTTAATTATTTAAAATTAAGAGAAGG
ATGGGTGAGAACTAGTGGATATGGTTTTGATTTAAAAACAAGTAACAAATACATTCATTT
GACCAATAATGCTATTTAAAAAAATTCAGAACAATATGGATAATTTGAGAATGGAAATTC
AATCAATTATGCAACTCTTAAAAAATATATTAATTCAATGAACAGCAAAGAAAGTGAAGG
AGTATGGGATGGAATCTAGCAAAAAATAAGAAATATAATTAAGATTACACTTTAAGCTAC
TTCAGATAAAATTAATATTTTTAATAGAGAAAAATAATTTGAGCTTTTTGGCTACGATTT
TATGATTGACTAGTCTTTTAAACCATGGCTTATAGAAGTGAACACTAATCCATGCATTGA
AGAATCTAGTGAAGTATTAAAACAAATTCTACCTAGGCTGATAGGTTATATTTATTTTTT
CAATATTTTTATAAATTAATTAATAAAATTTGTTGTTTATTTATTTAACTTTTAGATGAC
ATGTTAAGATTGACTATTGACTAGTTTTTTAGCAAGCAAACAAACCAAAATTAAAGTTTT
TTTCCCTTAATAGGCTACTCTAATGAGGATTCTATTTTTGAGTAATTTGAAATATGA