Identifiers and Description

Gene Model Identifier

TTHERM_00035680

Standard Name

TTLL14P (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt14402 | 2.m02313 | 3825.m02779

Description

Similar to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00035680

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00951.19.997093137033517e-262tubulin-tyrosine ligase (1346
aa)
OxytrichaContig19145.0.g899.998819815181669e-76Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_234731.7587922024243116e-25
WormBaseWBGene000441872.000620012690291e-23locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815417.997402223525235e-19DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.0000000020002373268528243PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00035680(coding)
ATGCAATCCGCGAATATTAGTAATAGTATAGCAGAGATTAATAAAATCTCATAATCCAAT
TATCTACAAAAGGAATCAACTCCGCAAGGCTTGATGCAGTCACCTCTTTTAGGGAGCAAT
AAGAAAAGATATTATGAATATCAAAATGAATATAAAAGCGATTTCAAGCCTAGCTAAGTT
TAACATATAGTTTTGATTGCCAAAAAAATAGAGAAACAATCTAGAGAAAGCAAAGGAAGC
CCAGTGCGTTTGCTGGGAGATAATAATTATAGAATACAAACAGCACAATATGGCAACAAG
TACACAAGAAATTATAATTAGCAGTTCACTTCTAATCTAATAAAAGGATAGACATTCTAT
GATACAGGTTATTATTCTAATTAAACTAAATAAGATTTAGGAGCTAACAACAATACTCCT
TCTTCAATTTTTAGCTATTCAGGTTTCTAGCAATAATAATTCGAATCATAGTATCAGTCA
GCAAATAACATGGGCAGAACTTTATCTAGTGTAAAAAACTATCCGCTAACAGGTTTTCAA
ACAAATAAGCCAGACATTTTTAGCTAAATCCAAAACTTTTAATAAAATTAACCTAGCAAA
AATGCTACATAAAATTAAAATACTTCTCCTAAATAGAAAAGTATTTAAAATGAAAAGTCG
TAAGAGAATAATCAACTATTAAAAATACATTATTCTAGCACAAATTAGACTCATAAATCC
CCTCTTCAAGGTAGATAGTTTTTTGTTAGTGAATTGAATAGATAAGTATCTGATTAAAAT
AACAATTTTACATCTGCTTACAGCTAGTAAGCATTTACTTATTAGTAAGGAGGAGGAAGA
AGTAGCTCTTCATAAGTATAGCAGAGTTCAAACTATATGCAAAATATATAGTTTTCACCT
AATTAATAAAATTTCTAGTAAATTGCTCAGAATAAAGAAGAATCCTATTACAAGTATATT
GTTAACTATGGGAATAATTGCCTTATTGTTAAAAGAGTCATGGAAACAAGAGAGAACTGG
AGAGCAATTGAAACTCACAATACAGCCTATAACTTTAGGTGGTGTCCTATTAGTTAAGCA
GTAAAATTTGATAGAATTGGAATAGGGATGAAATAGCTAGTTAATCATTTAGAGTTTCAC
AAAGAATTAACATGCAAATACACTCTGATAAAAAACTTAAAGCCTTATTGTGAACAAAAT
AAGATAAATATGTTCACTTTAACACCTTTAACATTTTTGATTGACTTAGATGATGAAAAT
TGTGATTCTTCTCTGAAAAGATTTGCAAAGTTTTTTTATAAGCACATGCCGAAGAACAGC
TCAGTTCTCAAAAAACCAGAAAATCCTAAAAAGGCTGTAAATGAATTTGTTAAACGCTTA
AAACCTCTTATGCAATATCCGATGCAGGATAAAAAAGAAAAACCGAATCCCTTTTCAAAG
CCTAAGATGCATGAATCTTTTGCAAATGGAGAAAACTACTTCTGGTTTTTAAAACCAACT
GGCACAAATCGAGGAAGAGGAATTTACATATTCAATTAAATAGAATAATTAGAAAAATAC
ATATAAGAGTACTACGTAGGGATGGAAGAGAAACCTTTAACAAAAAAAAAAGAAATAGTA
CCTAATAAGCAGGAGTAAGAATAATTATAATAATAATAATAATAATAATAGCTCCAACAA
CAAATCATAGAAGCTTAAAATTGTTAGCAGAAAAAAGAAAACTCTTAAGAAAAAGAATCT
AATTAGATTTAAGATTAAGATTAACTTGACTTCAAAAGTAAATTTTAGTTCTAACAAAAA
GTGATTCAGTAGCTCTAAAACCACTAGTAATAATTGCAAATTACGTCTGTTTCTCCAAAC
TTAAGGTCAAATGAAAACTATTCTCCAGAAAAAAATTAGTAAGACTAAAATGCAGATTAA
TCTAAGAAGAGAAAAAATACATAAAGTAGTGCAAATAAAGATCCTGTGAGTATCATCAAG
TGCCATCAATTTGTAGTATAAAAGTATGTGGAACGTCCAATGTTAATAAACAATAGAAAA
TTTGATATCCGTGCTTGGGTCCTAGTAACACATACTATGGATGTATATTTTTTTAAAGAA
AGCGTAATAAGAACTTCTGGTTAAAAGTTTAACTTAGACAACAATCAAATTAATAATCAT
TTCATTCATCTCACAAATAATGCTGTTTAGAGATATGCTGACAATTATGGAGAATTTGAG
AATGGAAATTAAATGAGTCTGGCTAATTTCTTTAAATACTGCTAAGCTCATCACCCAAAT
GAGTGTGATACAAGCAAAATGCATTAAGATATGAAAAACATTGTCTACCACACTATGAAT
TGTGTTAAACGTAAAATTAATCCTGAAGACAGAAAATACACTTTTGAAATTTATGGCTAT
GATTTTTTAGTAGATGATAAATTTAATATTTGGCTTTTAGAAATTAATACAAATCCATGT
TTAGATGAATCTTCACCTCACCTACAGCAGGCTTTACCTCGTATGCTTGACGATGCGTTT
AAATTAACCCTGGATATAATATTTCCAAAAACAAAAATTCTTTAAAAGTAGTAGCCTTAA
ATAAACAAATCACCTTCTCAAATAGTAAGCCCTGCAAAAGCAATGATGAAAGCTAAGAGC
CCTAAAACATTACAAAATATAACAAATAGTATAAGAACTGAATAAAATGAAACAAAATTA
GTTTTATAAGAAGAATAAGTAATTGTAGAAAATGAGTAACTACCATAAAGTCTCAATATG
ATAGATGGAAAATCTATCGTCTTTGAGAATAAAAATGAAAATAGCGATTCAGCATCTCCC
AAATGCAGTAGTACAACTCAGTAAGATAGTTAAATATCTAACTCTTAGCCAGGACATCCA
AACAATAGCAACTATATATACGTTTCAAGCACAGTAAAATAATCACTTCCTCAAAGACTT
ACTAAAAAAGAAACAAATTGGCCAGTAGACGGTTTTCCAGATGAAGAAAACATGTGGGAA
TTTTTGTTAAATATTTATTGCCCTAAACCAAAATCAAATCATTCATAAAAAAAATCAACT
TTTTGA


>TTHERM_00035680(protein)
MQSANISNSIAEINKISQSNYLQKESTPQGLMQSPLLGSNKKRYYEYQNEYKSDFKPSQV
QHIVLIAKKIEKQSRESKGSPVRLLGDNNYRIQTAQYGNKYTRNYNQQFTSNLIKGQTFY
DTGYYSNQTKQDLGANNNTPSSIFSYSGFQQQQFESQYQSANNMGRTLSSVKNYPLTGFQ
TNKPDIFSQIQNFQQNQPSKNATQNQNTSPKQKSIQNEKSQENNQLLKIHYSSTNQTHKS
PLQGRQFFVSELNRQVSDQNNNFTSAYSQQAFTYQQGGGRSSSSQVQQSSNYMQNIQFSP
NQQNFQQIAQNKEESYYKYIVNYGNNCLIVKRVMETRENWRAIETHNTAYNFRWCPISQA
VKFDRIGIGMKQLVNHLEFHKELTCKYTLIKNLKPYCEQNKINMFTLTPLTFLIDLDDEN
CDSSLKRFAKFFYKHMPKNSSVLKKPENPKKAVNEFVKRLKPLMQYPMQDKKEKPNPFSK
PKMHESFANGENYFWFLKPTGTNRGRGIYIFNQIEQLEKYIQEYYVGMEEKPLTKKKEIV
PNKQEQEQLQQQQQQQQLQQQIIEAQNCQQKKENSQEKESNQIQDQDQLDFKSKFQFQQK
VIQQLQNHQQQLQITSVSPNLRSNENYSPEKNQQDQNADQSKKRKNTQSSANKDPVSIIK
CHQFVVQKYVERPMLINNRKFDIRAWVLVTHTMDVYFFKESVIRTSGQKFNLDNNQINNH
FIHLTNNAVQRYADNYGEFENGNQMSLANFFKYCQAHHPNECDTSKMHQDMKNIVYHTMN
CVKRKINPEDRKYTFEIYGYDFLVDDKFNIWLLEINTNPCLDESSPHLQQALPRMLDDAF
KLTLDIIFPKTKILQKQQPQINKSPSQIVSPAKAMMKAKSPKTLQNITNSIRTEQNETKL
VLQEEQVIVENEQLPQSLNMIDGKSIVFENKNENSDSASPKCSSTTQQDSQISNSQPGHP
NNSNYIYVSSTVKQSLPQRLTKKETNWPVDGFPDEENMWEFLLNIYCPKPKSNHSQKKST
F


>TTHERM_00035680(gene)
ATGCAATCCGCGAATATTAGTAATAGTATAGCAGAGATTAATAAAATCTCATAATCCAAT
TATCTACAAAAGGAATCAACTCCGCAAGGCTTGATGCAGTCACCTCTTTTAGGGAGCAAT
AAGAAAAGATATTATGAATATCAAAATGAATATAAAAGCGATTTCAAGCCTAGCTAAGTT
TAACATATAGTTTTGATTGCCAAAAAAATAGAGAAACAATCTAGAGAAAGCAAAGGAAGC
CCAGTGCGTTTGCTGGGAGATAATAATTATAGAATACAAACAGCACAATATGGCAACAAG
TACACAAGAAATTATAATTAGCAGTTCACTTCTAATCTAATAAAAGGATAGACATTCTAT
GATACAGGTTATTATTCTAATTAAACTAAATAAGATTTAGGAGCTAACAACAATACTCCT
TCTTCAATTTTTAGCTATTCAGGTTTCTAGCAATAATAATTCGAATCATAGTATCAGTCA
GCAAATAACATGGGCAGAACTTTATCTAGTGTAAAAAACTATCCGCTAACAGGTTTTCAA
ACAAATAAGCCAGACATTTTTAGCTAAATCCAAAACTTTTAATAAAATTAACCTAGCAAA
AATGCTACATAAAATTAAAATACTTCTCCTAAATAGAAAAGTATTTAAAATGAAAAGTCG
TAAGAGAATAATCAACTATTAAAAATACATTATTCTAGCACAAATTAGACTCATAAATCC
CCTCTTCAAGGTAGATAGTTTTTTGTTAGTGAATTGAATAGATAAGTATCTGATTAAAAT
AACAATTTTACATCTGCTTACAGCTAGTAAGCATTTACTTATTAGTAAGGAGGAGGAAGA
AGTAGCTCTTCATAAGTATAGCAGAGTTCAAACTATATGCAAAATATATAGTTTTCACCT
AATTAATAAAATTTCTAGTAAATTGCTCAGAATAAAGAAGAATCCTATTACAAGTATATT
GTTAACTATGGGAATAATTGCCTTATTGTTAAAAGAGTCATGGAAACAAGAGAGAACTGG
AGAGCAATTGAAACTCACAATACAGCCTATAACTTTAGGTGGTGTCCTATTAGTTAAGCA
GTAAAATTTGATAGAATTGGAATAGGGATGAAATAGCTAGTTAATCATTTAGAGTTTCAC
AAAGAATTAACATGCAAATACACTCTGATAAAAAACTTAAAGCCTTATTGTGAACAAAAT
AAGATAAATATGTTCACTTTAACACCTTTAACATTTTTGATTGACTTAGATGATGAAAAT
TGTGATTCTTCTCTGAAAAGATTTGCAAAGTTTTTTTATAAGCACATGCCGAAGAACAGC
TCAGTTCTCAAAAAACCAGAAAATCCTAAAAAGGCTGTAAATGAATTTGTTAAACGCTTA
AAACCTCTTATGCAATATCCGATGCAGGATAAAAAAGAAAAACCGAATCCCTTTTCAAAG
CCTAAGATGCATGAATCTTTTGCAAATGGAGAAAACTACTTCTGGTTTTTAAAACCAACT
GGCACAAATCGAGGAAGAGGAATTTACATATTCAATTAAATAGAATAATTAGAAAAATAC
ATATAAGAGTACTACGTAGGGATGGAAGAGAAACCTTTAACAAAAAAAAAAGAAATAGTA
CCTAATAAGCAGGAGTAAGAATAATTATAATAATAATAATAATAATAATAGCTCCAACAA
CAAATCATAGAAGCTTAAAATTGTTAGCAGAAAAAAGAAAACTCTTAAGAAAAAGAATCT
AATTAGATTTAAGATTAAGATTAACTTGACTTCAAAAGTAAATTTTAGTTCTAACAAAAA
GTGATTCAGTAGCTCTAAAACCACTAGTAATAATTGCAAGTAAATTTGTTTTTTATGGCA
AATAATACATTTTTAAATTAAAAATTAATTAATAGATTACGTCTGTTTCTCCAAACTTAA
GGTCAAATGAAAACTATTCTCCAGAAAAAAATTAGTAAGACTAAAATGCAGATTAATCTA
AGAAGAGAAAAAATACATAAAGTAGTGCAAATAAAGATCCTGTGAGTATCATCAAGTGCC
ATCAATTTGTAGTATAAAAGTATGTGGAACGTCCAATGTTAATAAACAATAGAAAATTTG
ATATCCGTGCTTGGGTCCTAGTAACACATACTATGGATGTATATTTTTTTAAAGAAAGCG
TAATAAGAACTTCTGGTTAAAAGTTTAACTTAGACAACAATCAAATTAATAATCATTTCA
TTCATCTCACAAATAATGCTGTTTAGAGATATGCTGACAATTATGGAGAATTTGAGAATG
GAAATTAAATGAGTCTGGCTAATTTCTTTAAATACTGCTAAGCTCATCACCCAAATGAGT
GTGATACAAGCAAAATGCATTAAGATATGAAAAACATTGTCTACCACACTATGAATTGTG
TTAAACGTAAAATTAATCCTGAAGACAGAAAATACACTTTTGAAATTTATGGCTATGATT
TTTTAGTAGATGATAAATTTAATATTTGGCTTTTAGAAATTAATACAAATCCATGTTTAG
ATGAATCTTCACCTCACCTACAGCAGGCTTTACCTCGTATGCTTGACGATGCGTTTAAAT
TAACCCTGGATATAATATTTCCAAAAACAAAAATTCTTTAAAAGTAGTAGCCTTAAATAA
ACAAATCACCTTCTCAAATAGTAAGCCCTGCAAAAGCAATGATGAAAGCTAAGAGCCCTA
AAACATTACAAAATATAACAAATAGTATAAGAACTGAATAAAATGAAACAAAATTAGTTT
TATAAGAAGAATAAGTAATTGTAGAAAATGAGTAACTACCATAAAGTCTCAATATGATAG
ATGGAAAATCTATCGTCTTTGAGAATAAAAATGAAAATAGCGATTCAGCATCTCCCAAAT
GCAGTAGTACAACTCAGTAAGATAGTTAAATATCTAACTCTTAGCCAGGACATCCAAACA
ATAGCAACTATATATACGTTTCAAGCACAGTAAAATAATCACTTCCTCAAAGACTTACTA
AAAAAGAAACAAATTGGCCAGTAGACGGTTTTCCAGATGAAGAAAACATGTGGGAATTTT
TGTTAAATATTTATTGCCCTAAACCAAAATCAAATCATTCATAAAAAAAATCAACTTTTT
GA