Identifiers and Description

Gene Model Identifier

TTHERM_00475230

Standard Name

TTLL14K (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt02322 | 57.m00261 | 3709.m00121

Description

Similar to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

  • ( PF03133 ) Tubulin-tyrosine ligase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00475230

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13199.19.997093137033517e-262hypothetical protein (594 aa)
OxytrichaContig16784.0.g336.999281070199524e-80Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_234732.4426007377405277e-36
SGDYBR094W9.996273942859018e-26PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es
WormBaseWBGene000441871.0004572433669413e-23locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815417.001446474249442e-19DDB_G0281541 on chromosome: 3
position 4627625 to 4629265

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00475230(coding)
ATGTACACACCAAGCTCTTCTGCCTTAAAATTAAAACCGTATACATAAATTTCAACTGTT
CAAAGCAATGATTATTTAAAGACATAAAATGAAAGATCTAAACATAATCTGTATTTTAAC
ATACAAGAAAATAAATAAGATGACTATACTGATGAATCACAATTTTAGTCTAACGTAGAG
GTATTATTTAAATATCATAAAAACAAAGAAAACTTGGCAAGACTTCGCTTACAAACGTCT
AATGATGTAAGAATGAAAAAAGCTAATAAATCTAGAGAAAAGATAAATAATAACAAGGAT
GAACAAGCTGAACTAGAAGAAACAAAATATTTAAAATATAGCAAAAAGGAATTTAGGATT
AAATCAAGAAATAATTAGATTAAGCCGTTATTAATTAAAGATTAATAAAACAAAATGAAC
TCTCTGCTTTTATTAAGATAACCTTCTACAAAAGCATAGTTTACATACGTAGTAGAACCT
GGGAATAATTCTGAGCTCATAAAAAAAATATTAATGAAACGTTCCTGGATAACAGAAATG
AAGTAGAATTCTACTAGTTGGAATTTTAAATGGAAACCTACAAGCAGTGGTCTGCATTAC
GATGAATTAACGAAAATAGGAACTAAGAAGCAAAGTACTAATCATATATAATTTCATTCT
GAAATTTCCTCAAAAGCTAAATTATTTACAAATTTAACTTACTATGCAAAGACAGTTGAT
GAATAAGCATAATTTATAATTCCTTCTTCCTTTTTGCTAAACTTAGACTCAGAAAGTCTT
ACAGATGAATTAGATGAATTTTTTGATCTTTTTTTGACTGTATAAAACTCTACAGCATTA
GAAAATATATGGCTCCTTAAACCTACTGATACAAATAGAGGAAGAGGTATAAAACTATTT
AATAAGCTAGAATAATTCATGACTTATATGCAAGGCTATGGAAAAAATGGCTTAATTAGA
GAAAAATTAATAAAATTGGGAGTAATAAACGAAAATGACATCATTCAAAATTATAAATAA
AGCCAAGTATATGAACAATACAATACTAAAAACTTGTAAAATAAAAGTAAAAAAATTGCT
GGAGGGAAATAGTTAATAATTTAAAAATATCTAGAAAATCCTTTATTAATTACTAATAGA
AAATTTGATATGCGTATATGGGTTTTAATTGATTAAGATCTATAATATTATGTATTTAAA
GAAGGCTACATAAGATTATCATCAGAGATTTACAATCTAGACTCACAAAACTTAAACAAT
ATATTTATACACTTGACCAATAATGCAGTTTAAAAAACATCTTAAAATTATGGAAAATAT
GAAAATGGCAATATAATTTCCTATAAATAAATGAAAGATATTCTCAGTGAATAAAAACCA
AACATAAGCTTTGATTAAATTCTCAACTAAATTAAATAGTGTATTATGTACTCCATGACA
GCAGCTGAAAAAAAGCTAACAAAAAGAGTAAATAATAACACGTTTGAAATATTTGGCTAT
GACTTTATGGTTGATTAGTAAGGTGAAGTATCTTTGATAGAAATTAATTCAAATCCATGT
CTTGAAGAATCTAATTAACTATTATCCACTTTAATACCCAGAATGCTGAATGATGCATTT
AGACTTACAATAGATAAGATATTTAGTGCTAGTACTTCATATAGTGAATCTATTTCCAAT
AAAAGTAAATCCTTATTTTACATTAGTAGTATTGACTATCCTGTTGAAGGCTATAATAGC
TATGAAAATTTATGGGAGCTCATCGGATAATTAATATGA


>TTHERM_00475230(protein)
MYTPSSSALKLKPYTQISTVQSNDYLKTQNERSKHNLYFNIQENKQDDYTDESQFQSNVE
VLFKYHKNKENLARLRLQTSNDVRMKKANKSREKINNNKDEQAELEETKYLKYSKKEFRI
KSRNNQIKPLLIKDQQNKMNSLLLLRQPSTKAQFTYVVEPGNNSELIKKILMKRSWITEM
KQNSTSWNFKWKPTSSGLHYDELTKIGTKKQSTNHIQFHSEISSKAKLFTNLTYYAKTVD
EQAQFIIPSSFLLNLDSESLTDELDEFFDLFLTVQNSTALENIWLLKPTDTNRGRGIKLF
NKLEQFMTYMQGYGKNGLIREKLIKLGVINENDIIQNYKQSQVYEQYNTKNLQNKSKKIA
GGKQLIIQKYLENPLLITNRKFDMRIWVLIDQDLQYYVFKEGYIRLSSEIYNLDSQNLNN
IFIHLTNNAVQKTSQNYGKYENGNIISYKQMKDILSEQKPNISFDQILNQIKQCIMYSMT
AAEKKLTKRVNNNTFEIFGYDFMVDQQGEVSLIEINSNPCLEESNQLLSTLIPRMLNDAF
RLTIDKIFSASTSYSESISNKSKSLFYISSIDYPVEGYNSYENLWELIGQLI


>TTHERM_00475230(gene)
ATGTACACACCAAGCTCTTCTGCCTTAAAATTAAAACCGTATACATAAATTTCAACTGTT
CAAAGCAATGATTATTTAAAGACATGTAAAATACTTCTCAAATTCTTATTGAATTATTGG
TTGATTTGATGTTCTAAAACTATTGAGAATTTTATATTAAACAATAAAAAGAAAATGAAA
GATCTAAACATAATCTGTATTTTAACATACAAGAAAATAAATAAGATGACTATACTGATG
AATCACAATTTTAGTCTAACGTAGAGGTATTATTTAAATATCATAAAAACAAAGAAAACT
TGGCAAGACTTCGCTTACAAACGTCTAATGATGTAAGAATGAAAAAAGCTAATAAATCTA
GAGAAAAGATAAATAATAACAAGGATGAACAAGCTGAACTAGAAGAAACAAAATATTTAA
AATATAGCAAAAAGGTAAATACAAATAAATTCAGTTGATGTTTTTTGTAGAAATAAAAGA
GACTATTAATAACAACAAAAATAGTTTTTAGTATCTATTTCTTTTCTACTGATGTTAAAA
ACAATAACTACCTAATTTAATTATAGCAATATCAATTTTTTATTAAAGTAAAAAAAGAGT
AGTATTTAAGTTGATTTGATTTCCAATCAAAACTGATTCTTTCTTTAAATATTTTCATTT
AAAAATTAAGGAATTTAGGATTAAATCAAGAAATAATTAGATTAAGCCGTTATTAATTAA
AGATTAATAAAACAAAATGAACTCTCTGCTTTTATTAAGATAACCTTCTACAAAAGCATA
GTTTACAGTAAAATAATAAAAAACTTTTTATTTTTATATACACTGTACTACAAATATTAA
ATTAATTTACTGGAAATAAATAAATAAGTACGTAGTAGAACCTGGGAATAATTCTGAGCT
CATAAAAAAAATATTAATGAAACGTTCCTGGATAACAGAAATGAAGTAGAATTCTACTAG
TTGGAATTTTAAATGGAAACCTACAAGCAGTGGTCTGCATTACGATGAATTAACGAAAAT
AGGAACTAAGAAGCAAAGTACTAATCATATATAATTTCATTCTGAAATTTCCTCAAAAGC
TAAATTATTTACAAATTTAACTTACTATGCAAAGGTATGCAATCAACTAATATACTTAAT
TAAGATATAAATTAAAATCCCAAAAAAATAAATTCTATTTTTTTCCTTTTGATGTAATCA
ATCCCGAGAATGTCTTTGAGTTTTTTTTAGGCTTATTTATATTTAATTAATTTAAAAATG
AATAATCTATTTTTTCAAGAAAATTTTATTTCATTTGCATTCATATTTAGATTATTTTAT
AAATATTTGTAGACAGTTGATGAATAAGCATAATTTATAATTCCTTCTTCCTTTTTGCTA
AACTTAGACTCAGAAAGTCTTACAGATGAATTAGATGAATTTTTTGATCTTTTTTTGACT
GTATAAAACTCTACAGCATTAGAAAATATATGGCTCCTTAAACCTACTGATACAAATAGA
GGAAGAGGTATAAAACTATTTAATAAGCTAGAATAATTCATGACTTATATGCAAGGCTAT
GGAAAAAATGGCTTAATTAGAGAAAAATTAATAAAATTGGGAGTAATAAACGAAAATGAC
ATCATTCAAAATTATAAATAAAGCCAAGTATATGAACAATACAATACTAAAAACTTGTAA
AATAAAAGTAAAAAAATTGCTGGAGGGAAATAGTTAATAATTTAAAAATATCTAGAAAAT
CCTTTATTAATTACTAATAGAAAATTTGATATGCGTATATGGGTTTTAATTGATTAAGAT
CTATAATATTATGTATTTAAGTAAAATTAGTTTAGCTTACTTTTTTATAAGTTTTAATTT
ACATTAAAAATTAGAGAAGGCTACATAAGATTATCATCAGAGATTTACAATCTAGACTCA
CAAAACTTAAACAATATATTTATACACTTGACCAATAATGCAGTTTAAAAAACATCTTAA
AATTATGGAAAATATGAAAATGGCAATATAATTTCCTATAAATAAATGAAAGTAATTTTT
TATTATTATTTGAAATCCGTTTATTTGTTAAGTTATGTATTAACTTATTTAGGATATTCT
CAGTGAATAAAAACCAAACATAAGCTTTGATTAAATTCTCAACTAAATTAAATAGTGTAT
TATGTACTCCATGACAGCAGCTGAAAAAAAGCTAACAAAAAGAGTAAATAATAACACGTT
TGAAATATTTGGCTATGACTTTATGGTTGATTAGTAAGGTGAAGTATCTTTGATAGAAAT
TAATTCAAATCCATGTCTTGAAGAATCTAATTAACTATTATCCACTTTAATACCCAGAAT
GCTGAGTAAATTAACAAACTATCATTAATCAAATTAAAATTTTTATTCATTTACTTAAAT
AATTAAGATGATGCATTTAGACTTACAATAGATAAGATATTTAGTGCTAGTACTTCATAT
AGTGAATCTATTTCCAATAAAAGTAAATCCTTATTTTACATTAGTAGTATTGACTATCCT
GTTGAAGGCTATAATAGCTATGAAAATTTATGGTAATATTAATTATTTAAGATATTAAAG
ATTTATAAATATTTATTAAATAAGGGAGCTCATCGGATAATTAATATGA