Identifiers and Description

Gene Model Identifier

TTHERM_00295800

Standard Name

TTLL14I (Tubulin Tyrosine Ligase-Like)

Aliases

PreTt15690 | 27.m00350 | 3692.m00153

Description

Similar to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR02794 ) protein TolA
  • ( TIGR00648 ) recombination protein U
  • ( PF04691 ) Apolipoprotein C-I (ApoC-1)
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF00514 ) Armadillo/beta-catenin-like repeat
  • ( TIGR01396 ) flagellar basal-body rod protein FlgB

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00295800

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08845.19.997093137033517e-262tubulin-tyrosine ligase (1240
aa)
OxytrichaContig19333.0.g957.996368924424594e-135Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_181319.462629465836378e-57
WormBaseWBGene000083312.000620012690291e-23locus:ttll-5 status:Partiall
y_confirmed UniProt:O17720
protein_id:CAB02862.3
DictyBaseDDB_G02815413.9992896861436003e-19DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.0000000000009003435339752751PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00295800(coding)
ATGAAACCTATTTCTACAAGTGAAGCTACCAGCCCTGTGCTCAAAATAGACAAAAAATTA
GAAATCAAAGAAAAGAATATTTAGCAAGGAGATAAGTAGGCTCATAAAAACTATAAGTTT
TGTTTGTTTAATGGCAATAATTCTGTAGTTTTCAGAAAAATTTTATTATCAAGAGGCAAT
TGGGAAGAGATAAAAGAGAGCTAAATTGAAGAAAAGAGCATATTTTAGAACTCAAATTTT
ATTTGGAAAAGCTACAACTTTTCAGTTAGAAAATATGCTATTATTGAAGACATCCACAGA
AATAATCCTTTTAAGCAGATAATAAACCACTTTGAAAATAACAGAGGAATGTGCACTAAA
ACTGGTTTAATCCGCTCACTTAGTTCATATTACAGGCATTTAGATCCAGCTATTTAAGCA
AAATATACCGTATTTGATACATGTGCTACGAGTTTTGTTTTAACTGCCGGAATTAATGAT
GTTGAATTTACATCTTTTATGTCTCGATATAACGAAATAGCTAAAGGAAATTTTATTAAA
GAAAAAGTACCCAAAAAACATTGTTTAGAAAATATATGGTTGCTAAAGCCAGCTGATGCT
AATTAAGGTAGAGGAATAGAAATATTAAAAACTCAAAAAGATATAATAAGCTCCCTTGTT
TAAAAATAATGTAATTCTTACTGGGTAATTCAAAAGTATATTGAAAAGCCTTTATTGTAT
CATGGTAGAAAGTTTGATATTAGAATATGGGTGCTTGTCACTAAGTCAGGTGAAATATTT
ATCTATAAGCCAGGATACATAAGAACATGTTGTGATGAATATAATATGTAAGATATAGAT
GTTAACTTACATTTAACAAATAATTTTGTTTAAAAACACCATTAAAACTACGGATAGCAC
GAACCAGGAAACACTCTTCCACTAGAATGCTTGTTTGAATATATTGACTAGAAATTTGCA
AATGAAAATACAGAACAAGTTAACTTGAGAGAAAGAATTCACTAAAGAATGAAAGATTTA
ATAATAGATACTATTCTTTCAGTCAAGAAAAGTATGATAACTATAAAAAGATATAACAAT
TTCGAGCTCTTTGGATATGATTTTTTAATTGATGAAGACTTGAGAGTTTGGCTCATTGAG
GTAAACACAAATCCTTACATTGGAATACCTAATGATTTTATTAAAGAATTGGTACCAAGG
ATGGCAGACGATCTTGTAAAAATTGCTGTTGACCCTTTGTTTCCACCCTAAAATCCTCCT
GAAAGTTAAAATAATGATTTTGAGTTGATTTATTGTGAAAACGGTAGCAGTTTTAATAAT
GGAAACCCTAAGAATGTTAGATAGCCTTTTTCAGTTTCTCCCTATCCTCTATAAAAGCTT
GCTCAAAAACCAAACAAAGTTCAAAGATAGTATGGAACAAGTCTTTTATTTAATAATGTT
TCTAAACCCTAGTTATAATCTGAGCAAAATAATTCATAGGATGAAAATTAAGTAATAAAT
ACTTCAGAAGTAAATGATTAAACCAATTAATAAATAAAATAAAGAAGTGCTTCTGCTGCT
AGAATATCTTAAAATAATAATAAAGGAGGTTTTTCTCCAAATTTTTCTGTAGTAGAAAGA
AATGCTCATTCAAAATCACCAGAATCAAGATTTTTATCAAGTAACTTAAGGTCTGGTAGT
GCTTAGTAAATTAAAATGCAATAACTAGATAAGCAAACACTAGTTGAGAATGATTCTAAA
AAAAAGTTAGAAAGGCAAAAAACTGTGGAAGAGTAGGATTAAGAAGATGAGTAGCAATTA
GAAAATCTAAATCAAAATATAAATGAAAATATTCTCTAATAAACCAAACTTAATAGCAAT
AATCAATCTTATGATCCTGACTTAATGTTTTACAACCTCAAAAAGCTCCTTAATACTTAT
CTTTATGCAGATTTCTAACCATTTTATTAGCACATTAATAATATTCTAAGTAAAATGATG
AATTGGGAGTTAATGAGTGAGTAGGAATTAAAAGTTGTCGTAAAGACACTAAGATTTATT
TTAGAGTCTAGAATTTCGAATATTTTAGTTGATTAAAAGTATATTGAAAAACTCATATCA
GTTATAGATTCTCAAAATCACCCTATAGAAATACAAGAAGTCTCTCTTGAAGCCCTTTGC
ACAATTACTAAAAATGTCTCTAACAAAGTTAGGATTGTTTCAAAAAATATTATTCTTTTG
TTAATAAAGATAAGCCTCTCTAGCTGTGATGAAAAAGAAATGGAGAAATATGACAGAAAG
ATAAGAATTTTGGCAACTAATTGCTTAATACATTTAGGTGGAATTTATAATAGAAGATAA
TATATTCCAGGGGAAACAAGAGATAATGATAAAATAAGGAGATTAATTATTGAAAATGGT
GGCTTACTGGCTTTGCTGTGGATAAGAAAAAAGGTAAATGATAATGAAATCAAAAAAATT
TCATAAGATTTTATAGATAATTTGGATATCTCTGATTTTGAGCTACAGTATAATTTGGTA
AAGAAATGGAGAAAGGCTCTCTTTTATGGAGGCTAAATGAAACAGATATAAAAAAATTAA
TACAGCTAAGAGTCCTTATAATAATGTAATTTGAGTGGTGAATTGAGTATGCTCTAAGAA
AAGATTAAAGAAGAAAACGGATATGAAGATAGCAAAGGCGAAAATGTCTCTTCTTAACAA
AATGATAATGCATTGCAAAAGAAAACAAATACTTTTATGGCTAATATTAATTAAATCTAA
AAAGTTAAACTAAAAAATAATAATGAACCTACTCCTGAACAATATCCTGTCTTTTTGTAA
ACACTTGACTATTTTGATTTTTAAGGTAGCATGGATACTGCTGAAGATATTTACTTAACA
ATCAAAGAATAAATCATAAAAAGAGACAAGGAAGATAAATTAAAAAAAGAAATGGAAGTA
AAAAAATAATAGCAGTAAGAAGACGAAAGAAAATTACAACTCTTAGAAAGAAAAGCAAAG
GTTGAAGAATTTTAGAAAAAGAAAGAAGAAGAAAAATTGAAAAGGAAATTAGAAGAAAAA
AGAAGGGAAGAAAAACAGAAAGAGATTCTTGCATAAGAGGAGAAGAAAAGATAGTAAAAA
TATGAGGAAATGCAAAAGAGAAGAGAAGAGCTCAGAAGATTTTAAAAAATGGAAGAAGAT
AGAAGAAAATTTTAAGATGATGATGGGCAAAGAAAGAATATGGAAATAAGTAGATTAAAG
AGATACTTAGCACCTAAGTTATTAATAGAAGATCCTACATCAAAATAACAAATTGATTTC
ATAAACAGCAGAAACTTATTTATTAAATCTAAGGAAAACGATTAAAGCAATTTATTGAGC
ACTATTTAAAATCAAGTTAATAATTTTAGCAACAGATAAAATTAAACACAGAATAATAGC
TTTTTAGCAATTAAGGTAAGTAATAGTAGATAAAAACTCGCTTCTTTAAGTAATAGGAAT
ATTCCTTAATCTCCTACATTACTATAATCGAGTTAAGTTTTCTCAGACTCAATTTAATTA
TTAAGGCACCAAATGAAAAATTAGTTTACAAAAGATGATAATCTATTAAAGTAGTCTAAC
AAAATTATAATAAAATCCCCTAACTTGGCATAATCTTAATAGTTTGCAAACACAAAATAT
AGAAACTAAAGACAATTATCCCCTATTAAAGTTGATGAAGTATAATCAAATGGTATATAA
GAGGATATTTAAGAGGAATCCAAATAAGCAAACTAAATTCTTTTAGAAAACTAAGAAAAT
ATGTCAGCATCATAGTAGGTGTGA


>TTHERM_00295800(protein)
MKPISTSEATSPVLKIDKKLEIKEKNIQQGDKQAHKNYKFCLFNGNNSVVFRKILLSRGN
WEEIKESQIEEKSIFQNSNFIWKSYNFSVRKYAIIEDIHRNNPFKQIINHFENNRGMCTK
TGLIRSLSSYYRHLDPAIQAKYTVFDTCATSFVLTAGINDVEFTSFMSRYNEIAKGNFIK
EKVPKKHCLENIWLLKPADANQGRGIEILKTQKDIISSLVQKQCNSYWVIQKYIEKPLLY
HGRKFDIRIWVLVTKSGEIFIYKPGYIRTCCDEYNMQDIDVNLHLTNNFVQKHHQNYGQH
EPGNTLPLECLFEYIDQKFANENTEQVNLRERIHQRMKDLIIDTILSVKKSMITIKRYNN
FELFGYDFLIDEDLRVWLIEVNTNPYIGIPNDFIKELVPRMADDLVKIAVDPLFPPQNPP
ESQNNDFELIYCENGSSFNNGNPKNVRQPFSVSPYPLQKLAQKPNKVQRQYGTSLLFNNV
SKPQLQSEQNNSQDENQVINTSEVNDQTNQQIKQRSASAARISQNNNKGGFSPNFSVVER
NAHSKSPESRFLSSNLRSGSAQQIKMQQLDKQTLVENDSKKKLERQKTVEEQDQEDEQQL
ENLNQNINENILQQTKLNSNNQSYDPDLMFYNLKKLLNTYLYADFQPFYQHINNILSKMM
NWELMSEQELKVVVKTLRFILESRISNILVDQKYIEKLISVIDSQNHPIEIQEVSLEALC
TITKNVSNKVRIVSKNIILLLIKISLSSCDEKEMEKYDRKIRILATNCLIHLGGIYNRRQ
YIPGETRDNDKIRRLIIENGGLLALLWIRKKVNDNEIKKISQDFIDNLDISDFELQYNLV
KKWRKALFYGGQMKQIQKNQYSQESLQQCNLSGELSMLQEKIKEENGYEDSKGENVSSQQ
NDNALQKKTNTFMANINQIQKVKLKNNNEPTPEQYPVFLQTLDYFDFQGSMDTAEDIYLT
IKEQIIKRDKEDKLKKEMEVKKQQQQEDERKLQLLERKAKVEEFQKKKEEEKLKRKLEEK
RREEKQKEILAQEEKKRQQKYEEMQKRREELRRFQKMEEDRRKFQDDDGQRKNMEISRLK
RYLAPKLLIEDPTSKQQIDFINSRNLFIKSKENDQSNLLSTIQNQVNNFSNRQNQTQNNS
FLAIKVSNSRQKLASLSNRNIPQSPTLLQSSQVFSDSIQLLRHQMKNQFTKDDNLLKQSN
KIIIKSPNLAQSQQFANTKYRNQRQLSPIKVDEVQSNGIQEDIQEESKQANQILLENQEN
MSASQQV


>TTHERM_00295800(gene)
ATGAAACCTATTTCTACAAGTGAAGCTACCAGCCCTGTGCTCAAAATAGACAAAAAATTA
GAAATCAAAGAAAAGAATATTTAGCAAGGAGATAAGTAGGCTCATAAAAACTATAAGTTT
TGTTTGTTTAATGGCAATAATTCTGTAGTTTTCAGAAAAATTTTATTATCAAGAGGCAAT
TGGGAAGAGGTAACCAAGTTAATATTATGAATCAGAATTCTACTTAGTTAAAATTAGCAT
TTTAATTTAGCTAAATTAAAATAATATTAAAAAAAATTAGATAAAAGAGAGCTAAATTGA
AGAAAAGAGCATATTTTAGAACTCAAATTTTATTTGGAAAAGCTACAACTTTTCAGTTAG
AGTAAGCTTTTACATTTTTATTTATTGCGAGTACTTTGAAATATCATAATTATTTACAAA
TTTTTAAGAAACTATCTATACTTTGAACTAATAAAACAGCAAGTTCAAGAGTATCTAAGA
AAATTTTATAACATTTTTTAACAATACATAAAAAAAATAATTGTGCAACAAATTTTAGTA
AAGTATAAATTATTTAAACCTATTTTTAAATTTTTCATACAAAAAACTTAATGTTTATTT
ATATCTGTTGAAAAAATATAAGTAAATAAATTGTTGTTGAATATAAATGAGATTACTCAA
ATATAAATTAGAATACATTATTTTTAATCATTTTAATATATTAATTTAAATTAGAAATAT
GCTATTATTGAAGACATCCACAGAAATAATCCTTTTAAGCAGGTAAGTTCAATTTAAAAT
TATTCATTTTCATTAATTCCATATTAAAATCTCAACAGATAATAAACCACTTTGAAAATA
ACAGAGGAATGTGCACTAAAACTGGTTTAATCCGCTCACTTAGTTCATATTACAGGCATT
TAGATCCAGCTAGTAAATTACTTTTATTTTATTTTCATGCTAATATTTTTTATAGTTTAA
GCAAAATATACCGTATTTGATACATGTGCTACGAGTTTTGTTTTAACTGCCGGAATTAAT
GATGTTGAATTTACATCTTTTATGTCTCGATATAACGAAATAGCTAAAGGAAATTTTATT
AAAGTAATTAATTTAATTAAAAATTAATCTCCATCATCAAAATAAACTTAAAAATAAAAT
ATAGGAAAAAGTACCCAAAAAACATTGTTTAGAAAATATATGGTTGCTAAAGCCAGCTGA
TGCTAATTAAGGTAGAGGAATAGAAATATTAAAAACTCAAAAAGATATAATAAGCTCCCT
TGTTTAAAAATAATGTAATTCTTACTGGGTAATTCAAAAGTATATTGAAAAGCCTTTATT
GTATCATGGTAGAAAGTTTGATATTAGAATATGGGTGCTTGTCACTAAGTCAGGTGAAAT
ATTTATCTATAAGCCAGGATACATAAGAACATGTTGTGATGAATATAATATGTAAGATAT
AGATGTTAACTTACATTTAACAAATAATTTTGTTTAAAAACACCATTAAAACTACGGATA
GCACGAACCAGGTTCTTAGAATTTAATACGATTGCTTTTATATAAACGTTTTTTTTATTT
ATTGCAGGAAACACTCTTCCACTAGAATGCTTGTTTGAATATATTGACTAGAAATTTGCA
AATGAAAATACAGAACAAGTTAACTTGAGAGAAAGAATTCACTAAAGAATGAAAGATTTA
ATAATAGATACTATTCTTTCAGTCAAGAAAAGTATGATAACTATAAAAAGATATAACAAT
TTCGAGCTCTTTGGATATGATTTTTTAATTGATGAAGACTTGAGAGTTTGGCTCATTGAG
GTAATTTCAATCTCTTCTAAAAATTAATTTACAAAATTTTTTTATTTTAGGTAAACACAA
ATCCTTACATTGGAATACCTAATGATTTTATTAAAGAATTGGTACCAAGGATGGCAGACG
ATCTTGTAAAAATTGCTGTTGACCCTTTGTTTCCACCCTAAAATCCTCCTGAAAGTATTT
ACATTTACATGAAATTTTTTCTTAAAATAATATTATTAAATAGGTTAAAATAATGATTTT
GAGTTGATTTATTGTGAAAACGGTAGCAGTTTTAATAATGGAAACCCTAAGAATGTTAGA
TAGCCTTTTTCAGTTTCTCCCTATCCTCTATAAAAGCTTGCTCAAAAACCAAACAAAGTT
CAAAGATAGTATGGAACAAGTCTTTTATTTAATAATGTTTCTAAACCCTAGTTATAATCT
GAGCAAAATAATTCATAGGATGAAAATTAAGTAATAAATACTTCAGAAGTAAATGATTAA
ACCAATTAATAAATAAAATAAAGAAGTGCTTCTGCTGCTAGAATATCTTAAAATAATAAT
AAAGGAGGTTTTTCTCCAAATTTTTCTGTAGTAGAAAGAAATGCTCATTCAAAATCACCA
GAATCAAGATTTTTATCAAGTAACTTAAGGTCTGGTAGTGCTTAGTAAATTAAAATGCAA
TAACTAGATAAGCAAACACTAGTTGAGAATGATTCTAAAAAAAAGTTAGAAAGGCAAAAA
ACTGTGGAAGAGTAGGATTAAGAAGATGAGTAGCAATTAGAAAATCTAAATCAAAATATA
AATGAAAATATTCTCTAATAAACCAAACTTAATAGCAATAATCAATCTTATGATCCTGAC
TTAATGTTTTACAACCTCAAAAAGCTCCTTAATACTTATCTTTATGCAGATTTCTAACCA
TTTTATTAGCACATTAATAATATTCTAAGTAAAATGATGAATTGGGAGTTAATGAGTGAG
TAGGAATTAAAAGTTGTCGTAAAGACACTAAGATTTATTTTAGAGTCTAGAATTTCGAAT
ATTTTAGTTGATTAAAAGTATATTGAAAAACTCATATCAGTTATAGATTCTCAAAATCAC
CCTATAGAAATACAAGAAGTCTCTCTTGAAGCCCTTTGCACAATTACTAAAAATGTCTCT
AACAAAGTTAGGATTGTTTCAAAAAATATTATTCTTTTGTTAATAAAGGTAATAATAATA
ATATGCTTTTCTTTTAAAAAGAAAATTTTTATATAAAATTTGAATACAAAGCTTGAAATA
ATTTAAATTTTTTATGTTAGTTTACATTAAATTTTTTTATTTAATTAGATAAGCCTCTCT
AGCTGTGATGAAAAAGAAATGGAGAAATATGACAGAAAGATAAGAATTTTGGCAACTAAT
TGCTTAATACATTTAGGTGGAATTTATAATAGAAGATAATATATTCCAGGGGAAACAAGA
GATAATGATAAAATAAGGAGATTAATTATTGAAAATGGTGGCTTACTGGCTTTGCTGTGG
ATAAGAAAAAAGGTAAATGATAATGAAATCAAAAAAATTTCATAAGATTTTATAGATAAT
TTGGATATCTCTGATTTTGAGCTACAGTATAATTTGGTAAAGAAATGGAGAAAGGCTCTC
TTTTATGGAGGCTAAATGAAACAGATATAAAAAAATTAATACAGCTAAGAGTCCTTATAA
TAATGTAATTTGAGTGGTGAATTGAGTATGCTCTAAGAAAAGATTAAAGAAGAAAACGGA
TATGAAGATAGCAAAGGCGAAAATGTCTCTTCTTAACAAAATGATAATGCATTGCAAAAG
AAAACAAATACTTTTATGGCTAATATTAATTGTAATAATTTTTTTTGCTTACAATATTAT
TTAATTTTTTTTAACAAAGAAATCTAAAAAGTTAAACTAAAAAATAATAATGAACCTACT
CCTGAACAATATCCTGTCTTTTTGTAAACACTTGACTATTTTGATTTTTAAGGTAGCATG
GATACTGCTGAAGATATTTACTTAACAATCAAAGAATAAATCATAAAAAGAGACAAGGAA
GATAAATTAAAAAAAGAAATGGAAGTAAAAAAATAATAGCAGTAAGAAGACGAAAGAAAA
TTACAACTCTTAGAAAGAAAAGCAAAGGTTGAAGAATTTTAGAAAAAGAAAGAAGAAGAA
AAATTGAAAAGGAAATTAGAAGAAAAAAGAAGGGAAGAAAAACAGAAAGAGATTCTTGCA
TAAGAGGAGAAGAAAAGATAGTAAAAATATGAGGAAATGCAAAAGAGAAGAGAAGAGCTC
AGAAGATTTTAAAAAATGGAAGAAGATAGAAGAAAATTTTAAGATGATGATGGGCAAAGA
AAGAATATGGAAATAAGTAGATTAAAGAGATACTTAGCACCTAAGTTATTAATAGAAGAT
CCTACATCAAAATAACAAATTGATTTCATAAACAGCAGAAACTGTAAATTTATTTTTTTT
ACTAAGTTTAACAATATTAATTTATTTTACTAGAAAATTTTTAATTTATTTATGATTATA
TTAATTTTTTAAATTTAATCGCTTAATTTAAAAATAAATTAACAATAAAAGTCAATATTT
AGAATTGTTTTTTAAAAGTAAAAAATAAATTTCATTTATTTTTTGGTTTAATTGAATAAA
TGTTTCATTTTGAATTAAATAATAAAATTTTTTTATTTATGATTTTTTAGTATTTATTAA
ATCTAAGGAAAACGATTAAAGCAATTTATTGAGCACTATTTAAAATCAAGTTAATAATTT
TAGCAACAGATAAAATTAAACACAGAATAATAGCTTTTTAGCAATTAAGGTAAGTAATAG
TAGATAAAAACTCGCTTCTTTAAGTAATAGGAATATTCCTTAATCTCCTACATTACTATA
ATCGAGTTAAGTTTTCTCAGACTCAATTTAATTATTAAGGCACCAAATGAAAAATTAGTT
TACAAAAGATGATAATCTATTAAAGTAGTCTAACAAAATTATAATAAAATCCCCTAACTT
GGCATAAGTAAATTTTACATCAAATTAATTAAAGTAATTATTTAAATATAGTCTTAATAG
TTTGCAAACACAAAATATAGAAACTAAAGACAATTATCCCCTATTAAAGTTGATGAAGTA
TAATCAAATGGTATATAAGAGGATATTTAAGAGGAATCCAAATAAGCAAACTAAATTCTT
TTAGAAAACTAAGTAGATATTTAAAAAAAAATAATTTATCATAATATTAACGTCTTTTTA
TTAAATTAGGAAAATATGTCAGCATCATAGTAGGTGTGA