Identifiers and Description

Gene Model Identifier

TTHERM_001084299

Standard Name

TTLL14H (Tubulin Tyrosine Ligase)

Aliases

None

Description

tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_001084299

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20478.19.997093137033517e-262hypothetical protein (819 aa)
OxytrichaContig19333.0.g952.999467474389571e-105Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_351931.8521167695179754e-45
WormBaseWBGene000441879.99723014177113e-33locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815414.999245259173412e-21DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.000000009996807949091551PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_001084299(coding)
ATGGTTTACAAATTTATTGTTTATCCTGGTAATAATTCATTTGTCATTAGAGAAGCACTT
TTAAAAAGAGGGAATTGGAAAGAAGTATAGTATGATGATCCTAATATTAATTTATCTGAA
ATTGATTTCATTTGGTCACCAAACAGCCTTTCTACTAAGATAGTCATCAACCATTTTGAA
AATAATTAATCATTGACAACTAAATCTGACATGATAAAAGCATTGAATAATCATTACAGA
AAAAACTCAGAAGCATAAAAAGGAGGATATAATGTTTTCCACTCAATACCAGCTACCTAT
GTCCTTATAGTAGGTGTAAATGGCAATGATCAAAGAGATTTTCAAATTAAATTTAATGAA
ATATCTAAGTCTAATTTCAAAAGATGTACTCTTCCTGAAAAACACTGCTCTAATAACATT
TGGATTTTAAAGCCTGATAATATGTCTCAAGGAAAAGGAATAGAAATTTTTCAAAGTTTG
AAAGCTATTTTGAGCTTTTTACACTATAAACCTGCATTTAGTAAATGGGTTATCCAAAAA
TATATTGAAAGGCCTCTGCTATATAATGGAAGAAAATTTGATCTCAGAGTATGGGTTCTT
TTAACAAATAAGGGAGAGCTATTTGTCTACAAGAACGGATATCTTCGAACAAGTTCATCT
AAATACAGTATGCAAACGTTTAATGAAGCTGTACACCTCACTAACTGGAGTCTTTAAAAA
GGTCTTCCTAGTTATGAAAAGCATGAATAAGGAAATAGATTACCATTAAAGGAGGGATTA
TAATACATTTTTGATACTTAATTTAGTAAGTACCAAGTTGACTATGAAAAACACATTTAT
CCTAGAATGAAAGATTTGATTATTGATCTAGTAAGAAGCTGTGAACAAGAGATGTTTAAA
AGCAAGAAACTCAATAATTGCTTTGAGTTATATGGGTTTGATTTCATTATTGACGAGGAT
TTGAGAGTTTGGTTGATTGAAGCTAATAAGAACCCAGGATTCGGCTTACCTACTGAAAAG
GCTAGAAAATTGATTGACGAAATGGTAGATGAATTACTAAGGTTAACTATTGATTAAGAT
TATACACCTAAAGCTGCTCTTTAACCAAGATAAAATGTATTTGATTTAATATACACTATG
AAACCATCTCCATTTAACAAATTTTAACCAAAAAATGACAGAAGACCTTTCAATATAAGT
GTATATCCTATTCCATAACTTGAGCCATAATAATCTTCAGGAGAAAAGAGATATTAAGTT
CTTAATCCTTTACAGGATATTAAACAAGAAAAAGAAAAAAGCAAACAAACTGAGATGGAT
TATTCCATAGAGGTACTTAATGAAGAACAATAAAAAAAATAAAACCAAGAAGAATAAGAA
GATAAAAAAAGAGATGAGTTAACCTAAAAACAATAGAATGAAAAAATAATTGAAAGCAGA
TATACTCTAAAAGAGATAAACAATGATCCTTATATTTTCGAAAAAAACTTAGAATCTTAG
GAAATTTGCTTAAAGCAATAAAAGGAGTAAACTAAAAAATTTAAAAGTAAAGATAATCTA
GATAAAAATGTAGATGATATGTAAAAGGGGTTTGGTTTACAAGCACTAAATTCTTAAAAT
AGTAATAATAACCAATAAAGAATTCAAAAAATTATGTCGAGTACGCTATCACAGCCTACT
TTCCATCAAAATTTATTAAGTTTTGCTTTGAAATCTCCTAGAAAATTAGATCCCTTATTT
AACTCTGTTAAGTAATTTAAAGATTCTTCTTATATTTAAGAAGAGGAAGAAAACGAAAAA
AAAGATGAGTTTGCTAAATCATAAAAAATAAATTCCTACATGGTTTAGTCTTCTAAAATA
ATACTTGAGCCGATTTCATCTAACGATTAACAAAAAGAATTAATAAAAAGATTAAACTAA
TAGTAAAAGAATTTATATCAGTAGTTAAAAGAATTAAATGATAATTCTGCTTAAGATTAC
AATTAAACATCTTAAAAACTGAGTGATGGAAATTATACTCCAATCTAAACAATGTAAAAT
AAATCCTAAGAAAGGAAGAAAATGTTAAATAGATAATAAAGCAGGTCATTATTTAAAATA
AAGTTGTTGAATGAACAAAAAAATTAGTAAAAATAAGACTACTCAATTTAGCCGATACTT
GCAAAAAGTATGAGCACAACAAGTAATTGGATAAAATAATAATAAAAATAAGATATAAAC
ACCAATTTTCAAAAATATTAGATGGTTTAACAAAAAAAATTACCAGCTTTCTCACATTCA
CTTCATTAAGCTAATAAAAATAGTGAAATCAAGCAATTTAGCGAATAATAAAAAGAAATG
TAATAACCTAGCATATTTTAATAAAAAGAAAGTCTTTACATCTAAAAATAAGAATTAAGT
TATCTTAATCATATTTGA


>TTHERM_001084299(protein)
MVYKFIVYPGNNSFVIREALLKRGNWKEVQYDDPNINLSEIDFIWSPNSLSTKIVINHFE
NNQSLTTKSDMIKALNNHYRKNSEAQKGGYNVFHSIPATYVLIVGVNGNDQRDFQIKFNE
ISKSNFKRCTLPEKHCSNNIWILKPDNMSQGKGIEIFQSLKAILSFLHYKPAFSKWVIQK
YIERPLLYNGRKFDLRVWVLLTNKGELFVYKNGYLRTSSSKYSMQTFNEAVHLTNWSLQK
GLPSYEKHEQGNRLPLKEGLQYIFDTQFSKYQVDYEKHIYPRMKDLIIDLVRSCEQEMFK
SKKLNNCFELYGFDFIIDEDLRVWLIEANKNPGFGLPTEKARKLIDEMVDELLRLTIDQD
YTPKAALQPRQNVFDLIYTMKPSPFNKFQPKNDRRPFNISVYPIPQLEPQQSSGEKRYQV
LNPLQDIKQEKEKSKQTEMDYSIEVLNEEQQKKQNQEEQEDKKRDELTQKQQNEKIIESR
YTLKEINNDPYIFEKNLESQEICLKQQKEQTKKFKSKDNLDKNVDDMQKGFGLQALNSQN
SNNNQQRIQKIMSSTLSQPTFHQNLLSFALKSPRKLDPLFNSVKQFKDSSYIQEEEENEK
KDEFAKSQKINSYMVQSSKIILEPISSNDQQKELIKRLNQQQKNLYQQLKELNDNSAQDY
NQTSQKLSDGNYTPIQTMQNKSQERKKMLNRQQSRSLFKIKLLNEQKNQQKQDYSIQPIL
AKSMSTTSNWIKQQQKQDINTNFQKYQMVQQKKLPAFSHSLHQANKNSEIKQFSEQQKEM
QQPSIFQQKESLYIQKQELSYLNHI


>TTHERM_001084299(gene)
ATGGTTTACAAATTTATTGTTTATCCTGGTAATAATTCATTTGTCATTAGAGAAGCACTT
TTAAAAAGAGGGAATTGGAAAGAAGTAAATCTATTAAAAGATATATCATTCGCAAGAAAG
ATATGTTTTTGCATTTTAAATAGGTATAGTATGATGATCCTAATATTAATTTATCTGAAA
TTGATTTCATTTGGTCACCAAACAGCCTTTCTACTAAGGTATTACAATCCTTCTTTAATA
ATTCAATTTTTATCCTTGAATTTAAAAACTAGGAATATGAAAAGATTGTAGAATTAGAGA
AAAAAAATCCAAATCATCAAGTAAATTCTTTATTTATTTCTTCTATATAAGCATAGTAGA
GTTTACATATATCTTGATTTGATAACTCCTAGAAAAAAATATTAAAAATATGCTTAGTAA
CTTCAAAATATTTTGTAAATCTTTATAAATATTTACAATTAGATAGTCATCAACCATTTT
GAAAATAATTAATCATTGACAACTAAATCTGACATGATAAAAGCATTGAATAATCATTAC
AGAAAAAACTCAGAAGCATGTAAAAATGATATTTAAAATACTTTTTAACAAATACAATTA
CAATATTTCAAACACTTTGTTGAAATAAAATGTCTCATTATGTTTAATAATAATTAATTA
TGATTTTTAAAATAGAAAAAGGAGGATATAATGTTTTCCACTCAATACCAGCTACCTATG
TCCTTATAGTAGGTGTAAATGGCAATGATCAAAGAGATTTTCAAATTAAATTTAATGAAA
TATCTAAGTCTAATTTCAAAAGATGTACTCTTCCTGAAAAACACTGCTCTAATAACATTT
GGATTTTAAAGCCTGATAATATGTCTCAAGGTAATTATTCTACTATAATAGCTCAAATAT
TAATTATATAATCAAATTTAAAGGAAAAGGAATAGAAATTTTTCAAAGTTTGAAAGCTAT
TTTGAGCTTTTTACACTATAAACCTGCATTTAGTAAATGGGTTATCCAAAAATATATTGA
AAGGCCTCTGCTATATAATGGAAGAAAATTTGATCTCAGAGTATGGGTTCTTTTAACAAA
TAAGGGAGAGCTATTTGTCTACAAGAACGGATATCTTCGAACAAGTTCATCTAAATACAG
TATGCAAACGTTTAATGAAGCTGTACACCTCACTAACTGGAGTCTTTAAAAAGGTCTTCC
TAGTTATGAAAAGCATGAATAAGGAAATAGATTACCATTAAAGGAGGGATTATAATACAT
TTTTGATACTTAATTTAGTAAGTACCAAGTTGACTATGAAAAACACATTTATCCTAGAAT
GAAAGATTTGATTATTGATCTAGTAAGAAGCTGTGAAGTAAATATAAACTATTCTTTTTA
AAAATTATCTATCTAATTAAGTAAAATAATCAAATTATTTTTTTTTTTGGTAGCAAGAGA
TGTTTAAAAGCAAGAAACTCAATAATTGCTTTGAGTTATATGGGTTTGATTTCATTATTG
ACGAGGATTTGAGAGTTTGGTTGATTGAAGCTAATAAGAACCCAGGATTCGGCTTACCTA
CTGAAAAGGCTAGAAAATTGATTGACGAAATGGTAGATGAATTACTAAGGTTAACTATTG
ATTAAGATTATACACCTAAAGCTGCTCTTTGTAAATAAATATAAAAATTTATAAAATAAA
AATTCTAATAATTAAATAAAAAGAACCAAGATAAAATGTATTTGATTTAATATACACTAT
GAAACCATCTCCATTTAACAAATTTTAACCAAAAAATGACAGAAGACCTTTCAATATAAG
TGTATATCCTATTCCATAACTTGAGCCATAATAATCTTCAGGAGAAAAGAGATATTAAGT
TCTTAATCCTTTACAGGATATTAAACAAGAAAAAGAAAAAAGCAAACAAACTGAGATGGA
TTATTCCATAGAGGTACTTAATGAAGAACAATAAAAAAAATAAAACCAAGAAGAATAAGA
AGATAAAAAAAGAGATGAGTTAACCTAAAAACAATAGAATGAAAAAATAATTGAAAGCAG
ATATACTCTAAAAGAGATAAACAATGATCCTTATATTTTCGAAAAAAACTTAGAATCTTA
GGAAATTTGCTTAAAGCAATAAAAGGAGTAAACTAAAAAATTTAAAAGTAAAGATAATCT
AGATAAAAATGTAGATGATATGTAAAAGGGGTTTGGTTTACAAGCACTAAATTCTTAAAA
TAGTAATAATAACCAATAAAGAATTCAAAAAATTATGTCGAGTACGCTATCACAGCCTAC
TTTCCATCAAAATTTATTAAGTTTTGCTTTGAAATCTCCTAGAAAATTAGATCCCTTATT
TAACTCTGTTAAGTAATTTAAAGATTCTTCTTATATTTAAGAAGAGGAAGAAAACGAAAA
AAAAGATGAGTTTGCTAAATCATAAAAAATAAATTCCTACATGGTTTAGTCTTCTAAAAT
AATACTTGAGCCGATTTCATCTAACGATTAACAAAAAGAATTAATAAAAAGATTAAACTA
ATAGTAAAAGAATTTATATCAGTAGTTAAAAGAATTAAATGATAATTCTGCTTAAGATTA
CAATTAAACATCTTAAAAACTGAGTGATGGAAATTATACTCCAATCTAAACAATGTAAAA
TAAATCCTAAGAAAGGAAGAAAATGTTAAATAGATAATAAAGCAGGTCATTATTTAAAAT
AAAGTTGTTGAATGAACAAAAAAATTAGTAAAAATAAGACTACTCAATTTAGCCGATACT
TGCAAAAAGTATGAGCACAACAAGTAATTGGATAAAATAATAATAAAAATAAGATATAAA
CACCAATTTTCAAAAATATTAGATGGTTTAACAAAAAAAATTACCAGCTTTCTCACATTC
ACTTCATTAAGCTAATAAAAATAGTGAAATCAAGCAATTTAGCGAATAATAAAAAGAAAT
GTAATAACCTAGCATATTTTAATAAAAAGAAAGTCTTTACATCTAAAAATAAGAATTAAG
TTATCTTAATCATATTTGA