Identifiers and Description

Gene Model Identifier

TTHERM_01084300

Standard Name

TTLL14H (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt05949 | 225.m00052 | 3801.m00229

Description

Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01084300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20479.19.997093137033517e-262tubulin-tyrosine ligase (1621
aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_01084300(coding)
ATGAGTGAAATAATCAAAGATTAAAGAGAGGAAAAATACTCATCTATGTCTTTTGTTCCT
CATACTGATATGAATTCGCCATTAAAGATAGTTAGGAATAAAAGAATAAACTAGGTTTAA
TCAATGATCGATTTAGATAAATATAAAGAGCAATACATCAAAAAACTCATAGTCGATAAA
AATTTAATTGATATTTCTCCATAAATAACACATTCTAAAGCTATTTAAAACTCATATTAC
ATAAACCCTAATTTTACTGATGCCTTAAATACGTAAATGTAGCCTAACGTCAAAAAAAGT
TAATAAAGTCTACTATTTAAACAAATCTAAAGGCATTAGTTTCCTGAACGTGGGGTTTTT
AGTAAAAATTTATTTCTTTAAAGCAGTAAGACCATAAAAAACATAGGTAAAAGCGTTCCA
CCATCAATTCAATAGTCCATGTACAATATCCTTCTCGATTAGTCTCATACTCCTACAAAA
GTAGAAGAATCCTACTTAAAAGAAACAAATAATAAACAAAGTAGAATGAGCAGTATTATT
TTGAATAATGACAATGATAGTATCTTTTACTAAGGTAGGGGTTCTTATAAAGCCCCTTCT
CCAGAAAAAGACATGCTAATAACTAGATCTAAACTAAAAAAAACTTCTCTTTAACTTCCA
TCTGTTTCTTCTCCCATAAATAAAAAAGAAATGGTCTATCTCAGCAATAGCAAAAGTACT
CGCTCAAAAACTATAGAAAAAATAGATGATAAGTTAAGTAACAATCCATTTTTACCAAAT
ATAACATAAAGGAAGCAAAATAAGCTAAATATATCAATTCAAGGAGCATCTCGCAGAAGT
TCTAATAAGGAAGATTCTTAGTTTGACTTAGGCTTAAGTTCATAATAATAGATCGATCTT
TTTAATATTATACTCAATTCTTCTAAGAATATAACCATCCCTTAAATAGCTACAGGAACT
AATTTATAAAATAACTCTAAATTTAATAGCTTGAAACAAATTTTCAATCAAAGAAGTGCA
AGTTAACCATTGATAGATGAGTAAAACAGTCCCTAAGTTAATTCTCCAGTTTCTTCAGAA
AAGAGCAAGCATCTTCTTGAAAAATCAGCACTTAATAATTACTCAAATTCATAGCTAAGA
GAAAATATAATTAAAGAATTATCTTTAACACTAGCATAATGCATTAAATAGAATAAAGAG
CTTAATGAAGCATCTTACGACTTTTAAAATTTTTAAACTAAGAATGATTACTAGAATTCC
GAAGTAAAAGTTTTAGGATATTAAATACGTAAAGAGTAAATAGTAGAGCAGTATTAATAA
AACAAGGGTAATGATAGGATACAGAATTTTGCCAATTATCTCAGTAAGTTTTCAGGTTAT
ATAATGGATCTATTATTTGGTGATATACCAAAAATTACTAAGGGAGAAGTTGAATTCGAA
ATCTAGCTAACAGAATAAGTATAAGATATAATTTTACCTATTATATTAGAGAAATTAAAA
GAATTTGGAATGAAAGATTTAATAGAAAGATATCAATTAGTTTTTAAAAATGAATACTAA
AATATGATAATTAAGACTCCTATTATTTAAGAAAATTAAATTGAAGAAGCTGCTGAATCT
ATAACATAAGAATTATTAGCAAGACTTAAACTTCATTTCTAGAAAAGCTTCACCATGTAT
GCCTCAACTTGTAAGGATTTGATTAAAGACATTCTTTCAGAGGGAGTTAGTAAAGAAAAA
ATAAAAGATTACATGGAATTCTTGAGGATGCATTTAAAGAGATCTTCAATTTTTGAATAG
CCTTAAAATAAAAATATCAATACTCTTAATCATTAAAATAAAAGTGAATAGCATAAAGGA
ATAGTGGAAAGTGGAAACTATAAAGAATTGCTTAGCATTTCAAGTGCAGATTTGTTTTTT
ATCAAAAAAACTATTTATGAGGTGTTAAAGAAATAATGTCCAAATCTATCTTTAACAAGC
AGGGCAAGAATTTTGGAAAAAGTAGAGAGTTTAAGATTTGGATATTTCAAAGAAGTGTAC
AGCTTGAACGAGAAGTCTAATTAGTAGCTGATTGAGATTATGAAAGTTTATGTATCGAAT
TCTCCTCCTCTTCTTGCCTATCTAAAAAGACCAGAATCCAGCAAGTAAATAACAAAGCTG
CTAACTATTCTTCTAGACTCTATTTTGGGTGATTGTTCTCTCTAACATTTTGTTGAAAAA
TCTTCAATTTTATTGAATTAAGAGTTAGATTTACCTTTAATATCTATGTTGGAGTAGGGT
GTCAAGGGATCATTAGCTTAACTTCAAATAAATATTGTTTTGATAAAAGAAATCGAATAT
AAATTTACTAATTTGAAAAGAAGGGTAAGACTTACACCTCCATTTAATGCTGTTTTTTAT
CAAATTGATTCAATTATAAAGTACATGAATAGTTGGATAGATCTTATGGCATAATAAAAA
TAAATAAAAATAGATAATTAACAAGAATTGTTATCTCAACTTAAATAAATTGATTTCTTA
GAATTTTTCTTAGTCTGTTCTCTCTCAGATTTTGACACATTTTCATTTATCGATCTTTAA
GATGGATTGAAGTATTTTAAAGTGAGAAAAGAAGTTTTCAAATTTTGGCTAAAAGGTATT
AAGAGAATATTTGCAAAATTGAAACTAAAATAAAAGGAAATAAACCTGATAGATGATTAC
TTTTAAAAAGCATTTAATAACACTCAATTTTGA


>TTHERM_01084300(protein)
MSEIIKDQREEKYSSMSFVPHTDMNSPLKIVRNKRINQVQSMIDLDKYKEQYIKKLIVDK
NLIDISPQITHSKAIQNSYYINPNFTDALNTQMQPNVKKSQQSLLFKQIQRHQFPERGVF
SKNLFLQSSKTIKNIGKSVPPSIQQSMYNILLDQSHTPTKVEESYLKETNNKQSRMSSII
LNNDNDSIFYQGRGSYKAPSPEKDMLITRSKLKKTSLQLPSVSSPINKKEMVYLSNSKST
RSKTIEKIDDKLSNNPFLPNITQRKQNKLNISIQGASRRSSNKEDSQFDLGLSSQQQIDL
FNIILNSSKNITIPQIATGTNLQNNSKFNSLKQIFNQRSASQPLIDEQNSPQVNSPVSSE
KSKHLLEKSALNNYSNSQLRENIIKELSLTLAQCIKQNKELNEASYDFQNFQTKNDYQNS
EVKVLGYQIRKEQIVEQYQQNKGNDRIQNFANYLSKFSGYIMDLLFGDIPKITKGEVEFE
IQLTEQVQDIILPIILEKLKEFGMKDLIERYQLVFKNEYQNMIIKTPIIQENQIEEAAES
ITQELLARLKLHFQKSFTMYASTCKDLIKDILSEGVSKEKIKDYMEFLRMHLKRSSIFEQ
PQNKNINTLNHQNKSEQHKGIVESGNYKELLSISSADLFFIKKTIYEVLKKQCPNLSLTS
RARILEKVESLRFGYFKEVYSLNEKSNQQLIEIMKVYVSNSPPLLAYLKRPESSKQITKL
LTILLDSILGDCSLQHFVEKSSILLNQELDLPLISMLEQGVKGSLAQLQINIVLIKEIEY
KFTNLKRRVRLTPPFNAVFYQIDSIIKYMNSWIDLMAQQKQIKIDNQQELLSQLKQIDFL
EFFLVCSLSDFDTFSFIDLQDGLKYFKVRKEVFKFWLKGIKRIFAKLKLKQKEINLIDDY
FQKAFNNTQF


>TTHERM_01084300(gene)
TTTTAATTGCTTTTAAGTAGAAAAAGAATAAAGAAAAACAAAAATATACATACAGTAATT
ACTTTTCAAATCCATTTATAAAATAAGATTTTAAAAAATCTGATGAGTGAAATAATCAAA
GATTAAAGAGAGGAAAAATACTCATCTATGTCTTTTGTTCCTCATACTGATATGAATTCG
CCATTAAAGATAGTTAGGAATAAAAGAATAAACTAGGTTTAATCAATGATCGATTTAGAT
AAATATAAAGAGCAATACATCAAAAAACTCATAGTCGATAAAAATTTAATTGATATTTCT
CCATAAATAACACATTCTAAAGCTATTTAAAACTCATATTACATAAACCCTAATTTTACT
GATGCCTTAAATACGTAAATGTAGCCTAACGTCAAAAAAAGTTAATAAAGTCTACTATTT
AAACAAATCTAAAGGCATTAGTTTCCTGAACGTGGGGTTTTTAGTAAAAATTTATTTCTT
TAAAGCAGTAAGACCATAAAAAACATAGGTAAAAGCGTTCCACCATCAATTCAATAGTCC
ATGTACAATATCCTTCTCGATTAGTCTCATACTCCTACAAAAGTAGAAGAATCCTACTTA
AAAGAAACAAATAATAAACAAAGTAGAATGAGCAGTATTATTTTGAATAATGACAATGAT
AGTATCTTTTACTAAGGTAGGGGTTCTTATAAAGCCCCTTCTCCAGAAAAAGACATGCTA
ATAACTAGATCTAAACTAAAAAAAACTTCTCTTTAACTTCCATCTGTTTCTTCTCCCATA
AATAAAAAAGAAATGGTCTATCTCAGCAATAGCAAAAGTACTCGCTCAAAAACTATAGAA
AAAATAGATGATAAGTTAAGTAACAATCCATTTTTACCAAATATAACATAAAGGAAGCAA
AATAAGCTAAATATATCAATTCAAGGAGCATCTCGCAGAAGTTCTAATAAGGAAGATTCT
TAGTTTGACTTAGGCTTAAGTTCATAATAATAGATCGATCTTTTTAATATTATACTCAAT
TCTTCTAAGAATATAACCATCCCTTAAATAGCTACAGGAACTAATTTATAAAATAACTCT
AAATTTAATAGCTTGAAACAAATTTTCAATCAAAGAAGTGCAAGTTAACCATTGATAGAT
GAGTAAAACAGTCCCTAAGTTAATTCTCCAGTTTCTTCAGAAAAGAGCAAGCATCTTCTT
GAAAAATCAGCACTTAATAATTACTCAAATTCATAGCTAAGAGAAAATATAATTAAAGAA
TTATCTTTAACACTAGCATAATGCATTAAATAGAATAAAGAGCTTAATGTAAATGAATAC
TTTTGTTTATTTATTTATCTTTATTTTCTATTTTTAACATAGAAACTATCTCTTATTTTC
TTAAATTTAATCAATCAGTTCTACTGATGTATTTAATTAAAAACTTTGTATGTAATTGAT
ATTTTGATTTAAATTGGGTAAATAGTTAAAAATTTTAATCAAAAATAGGAAGCATCTTAC
GACTTTTAAAATTTTTAAACTAAGAATGATTACTAGAATTCCGAAGTAAAAGTTTTAGGA
TATTAAATACGTAAAGAGTAAATAGTAGAGCAGTATTAATAAAACAAGGGTAATGATAGG
ATACAGAATTTTGCCAATTATCTCAGTAAGTTTTCAGGTTATATAATGGATCTATTATTT
GGTGATATACCAAAAATTACTAAGGGAGAAGTTGAATTCGAAATCTAGCTAACAGAATAA
GTATAAGATATAATTTTACCTATTATATTAGAGAAATTAAAAGAATTTGGAATGAAAGAT
TTAATAGAAAGATATCAATTAGTTTTTAAAAATGAATACTAAAATATGATAATTAAGACT
CCTATTATTTAAGAAAATTAAATTGAAGAAGCTGCTGAATCTATAACATAAGAATTATTA
GCAAGACTTAAACTTCATTTCTAGAAAAGCTTCACCATGTATGCCTCAACTTGTAAGGAT
TTGATTAAAGACATTCTTTCAGAGGGAGTTAGTAAAGAAAAAATAAAAGATTACATGGAA
TTCTTGAGGATGCATTTAAAGAGATCTTCAATTTTTGAATAGCCTTAAAATAAAAATATC
AATACTCTTAATCATTAAAATAAAAGTGAATAGCATAAAGGAATAGTGGAAAGTGGAAAC
TATAAAGAATTGCTTAGCATTTCAAGTGCAGATTTGTTTTTTATCAAAAAAACTATTTAT
GAGGTGTTAAAGAAATAATGTCCAAATCTATCTTTAACAAGCAGGGCAAGAATTTTGGAA
AAAGTAGAGAGTTTAAGATTTGGATATTTCAAAGAAGTGTACAGCTTGAACGAGAAGTCT
AATTAGTAGCTGATTGAGATTATGAAAGTTTATGTATCGAATTCTCCTCCTCTTCTTGCC
TATCTAAAAAGACCAGAATCCAGCAAGTAAATAACAAAGCTGCTAACTATTCTTCTAGAC
TCTATTTTGGGTGATTGTTCTCTCTAACATTTTGTTGAAAAATCTTCAATTTTATTGAAT
TAAGAGTTAGATTTACCTTTAATATCTATGTTGGAGTAGGGTGTCAAGGGATCATTAGCT
TAACTTCAAATAAATATTGTTTTGATAAAAGAAATCGAATATAAATTTACTAATTTGAAA
AGAAGGGTAAGACTTACACCTCCATTTAATGCTGTTTTTTATCAAATTGATTCAATTATA
AAGTACATGAATAGTTGGATAGATCTTATGGCATAATAAAAATAAATAAAAATAGATAAT
TAACAAGAATTGTTATCTCAACTTAAATAAATTGATTTCTTAGAATTTTTCTTAGTCTGT
TCTCTCTCAGATTTTGACACATTTTCATTTATCGATCTTTAAGATGGATTGAAGTATTTT
AAAGTGAGAAAAGAAGTTTTCAAATTTTGGCTAAAAGGTATTAAGAGAATATTTGCAAAA
TTGAAACTAAAATAAAAGGAAATAAACCTGATAGATGATTACTTTTAAAAAGCATTTAAT
AACACTCAATTTTGAAATAAAAACTATATAAAAATACTGTAAATAATAAATAAATCTTTA
AACTTGTCTCTAATTTTTTACTTTTGTAATAAATTAGTTTACTAACTAACTATATTTGTA
ATAAAAATAATTTGCTTTGTATTTATTTGTAGATAAATGTTTAAATTTT