Identifiers and Description

Gene Model Identifier

TTHERM_00624190

Standard Name

TTLL14B (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt07407 | 87.m00187 | 3814.m00891

Description

Related to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00624190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12001.19.997093137033517e-262tubulin-tyrosine ligase (1206
aa)
OxytrichaContig1329.1.g1192.0005752503420762e-105Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_360534.590938473882946e-48
DictyBaseDDB_G02815418.998359040303252e-24DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
WormBaseWBGene000441873.999970367130025e-21locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
SGDYBR094W0.000000000010004361180063202PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00624190(coding)
ATGATAAAAGGTTAAAAAGATAGTAACTTTTACTCTTTAAATTAAAGGGCGAATATTTCT
AACCAAACGCGCTAGACTATCATAAAAAGTAGTTAAGAGAGGAATAGAAATAGGAATTCA
AGGACTGAGAGCAATCACATGAGATAGTAAAATTCAATATAGCAAATTTAAGATTGGAAA
AACCATCCAATAGGCCGTCTTTATATTGAAGGAATGACAAGTAATTTAGTAAATCATTAA
AGTGCCAATAAAGTATTAGATTTAAATGGAAATGCTGATAACTATACTTTAAATGTTTAA
AAGATAGAAAATGATATAAATAGCATGATTAAGAGTGCGAATAATGATTATATTGATGGA
TAAAACGATGGAAAGTAATTTAATGATTCTAACTAAATAAATACTAATGAATAGAGAATA
CTATAATAGCAATAAAATGTTTAGAATGTTTAAGGGAATCCTATGGTTTATAATAAAAAT
GTTCTCTAAGGAGGAATATCATATAGGATTAAAAAGAAAAATGATAACCAGATTCGAGCA
GTGACAAATAGTAGTCTCGATTAAAGAAACTTAAATTATACTTAGAATATGATTTAGTAA
TTATAAAGTTCATTAATATAAGACTAAATTACTTAAAGGGATAATTCATTACAAAAGAGC
AGTAATCCAGATATTATTTAAAGCTAAATAATTAGTAGTCCTGAAAAAATGCCATATCCT
TACAGAAAAAGAGAATACTCAGCAGATAGTAGAAATCAGTACTAATAATAATTTAATGAA
GCAAAAAACTTCTTTTAAAATTAACAAGCAGCTTAATAGTTAAGCAATTATAATGCTCTA
AATAATAGCTTAAATTAGTAAACTTATCATCCAAATCTCTTAACTATTGGAGCTTAGAAA
ATTAACTATCAGTAAAATTAATCATAACTCCATAACAATGGATCAACTAAAAGCTTTAAC
TAATCACCTCCAGTCCATGGTATTAAAAATTTAGATAAATCTTATATGTCAGCTTCTCCT
GAGTGGTAAAATTAACAGTAGTAATACTAGCAGAATTAGTAAGGAGCAAATCCATATTAA
ATTCCTTAAAATAAAATGCAAAATATTATTAAAGAAATGAGATTTCCTTAGAGTCCTATT
AATTCAATACACAATTAGCACAGTCGACTTTACGATTACAACTAAGGTTATAGCTAAAAT
TTAAATGGGTACACAACTTAAGAAGATCGAAATAAAATACTTAAAAAAATATTAGCTCAC
TTTAATGTTAAAGTGCAGTAAATGGAAAGAAAATAATTCATGAATATTTTTGGTTTGGAA
ATTAAATAGATACCACCTTAAGATATTAGTAAATCTCATAGATTGAATGCTAATCAAGCT
TATTACAATAGTTTGAACACCAAAAGATAGTAAAAAATAAATAATCTTTCAGAAATGATA
AATAGCAATTTAGCTGAGAATAGGCAAAATGTTAATTTAAGAAATAATAAACAGATGGCT
GCAGGTTCTAATAAGCTTAATCAGACAATGAATAATGGACAACAGGGTTTAGTTGATAAA
AGATAAGCGTATAGAAGCAATAGCTCAGATCAATAGTTAATTTTAAGTGGTATTGCTGAA
ATGAATGAGTAAGCTAGCTCTCCTATGGGAAAAGACAAATTATTTGGATTTAATGAAAAC
AATAATTAGCAAGAAAGATATGATCAAAATGGAAATTTGATATAACAATCTCTGACTCCA
GGAAATAATCCAAACGAATAACAAAATGATTACTATGAACAAAAAAATAGCTAACCTTCA
AGCGAATCTGAGTCTACCAAAGAATCAAATGGTTAAGTGAATGGATTATCTAACAACAAT
CAAAGTAACTTATAAGGATTAAATTAATAAGATAGGGTAAATACTCCTTCAGGAGGAGGT
TAAAATAGAAAAAGAATTAACTAATCCTTGAATTCTCGTCCAAGTAATTAGGCGATGATG
ATGGTAAGAAGATTACCAAAAAATAATGGAAATAAAAACTTTTAATTCTCTATGAACGAT
AACAATCTTTAACGTGAAGAAATATTCTTTAAAAAGTTTAACACCTATAAAGATTTTATA
TTTAAAATTAATTTTGGCAGTCATTACTTTGTTACAATGCCACAAGAAAATCCAATTTAT
AAAATCTGTGTTGGGCGTGGAAATAACAGTAAATTGATAAAAAATTGCATCAAAAATAGA
TGGTGGTGGCAAGTCTTAGATTATGATTAGCACCTCGAGTGCAACTTCCTTTGGACCTAA
TGTAAAGTATAACCATTCTTCGATAAATAGGAAAACTTAGATCCTCCACACACTGAAGAG
GATATCAATAAAGATGATTACATATCTCCTGAATTTCAAATTAGTAGAGCAAAAGTTGTG
TTTCAAGAAGTTGATGGTAAAGATTCTCCTGATGATATGAATTAAACAAGTAGAGTTTTC
AACAAGCTACAAAGTTCCCCTGATAAAAGATTCAATTAAAAGCAAAATCAAAACAACAAT
AGCAGTAATTAAGGAAATGGTAGTAATACTGCTGCTTTTAAAGGAGGAGTAAATGATGCT
AAGTAAAATGGTAGCTCTATTAATAAGTAAGCCAACCCCTTCCCACAATATTCTGATCAC
AACTTAAAAATATTCTCATAGTAAGACTATCAGATGTATTATAAATATATGAATAGCTAG
CCAGGCTAAAGAGATTATTATATTTAAAATTGGGATGATTTAAGTTTTCGTCTTAAAAAT
TTAAAAAGAACAAATATTGATAAGCCCTATAAAATTCTTGAAAATAGTTAAAAATAAATT
ACTCATAATCATTTGTAATTTAATTACATGTTAGGAAATAAAAAGGCATTATTCTATAAC
ATGAGACAATATTATCAACTCATGAAAGATGATGTTTTTAATTATCTCCCTTTAACTTAC
CATTTAACTAGAGGAACAGAAGATAAAGAATTCAGAAATTTCTTAAAGAAATTTAAAGAG
ATAGAGAACTCTAATAATGATAATGATGAGTCTAAGAAGTCTTAGAAAAAGATGAAAAAT
GTCTGGATTGTTAAGCCAGGAGAAATCACTAATAGAGGAAATGGTATACAAGTCTGTGAT
AATTTAAATGATATAAAGCGTATATTAACAAGTAAAGAAAAGCATAATAATGGAAAAGAT
AAAACATATATAGTCTAGAAATATATTGAAAGACCTTTCCTCTATAACAGAAGAAAGTTC
GATATTAGAGCATACATGCTTATTACTTGCATTAATGGAGTTCTCAGAGGTTATTGGTAT
TAAGAAGGTTACATCAGAACTAGTGGAAGAGAATTTGACCTTTCAGATGTTTCTGACGTA
TTCATTCATCTAACAAATGATGCTATATAAAAAGATTGTGAAGAATATAATAAGTTTGAA
CCAGGAAATAAATTATCATATTTTGAATTTTAGAGATATTTGGATATATGGTATTCTGAT
TAAAAGTATAACCTTTACTCTTAAATTTTACCGAAAATGAAAGCAATAGCTACCGATTCT
ATCAGAGCTACTTTTCTAAAGTTAGACCCACAAAGAAAGCAGAATAATTTTGAAGTTTTT
GGTTTAGATTTTATGATTGACGATAAATTTAAACCCTATTTGATAGAAATAAATACTAAC
CCAGCTATAGAAACAACATGTCCAATATGCTTAAGAGTTATACCTGGAATGATTGAAAAT
GCTTTTAGAATTGGTCTTGACCCTTTATTCCCTCCTCCACAAAATTGGCCAGGATAAAAA
AAGCATTTAGCCCCAGATTCATTAACTGAGCATAATAGATTTGAAATTATATTTGATGAA
TAATACGATGGAATAGAATTAAAAAGACTCTATAAAAACCAAGAAAATTGTCTTGAAGGA
ATGAATGATCTTGATGAAGATGAGGAAATTGACGATGAAAAGAGTAACAAGGATAAGGAT
GAAGATAAAGAAATTGAATATGACTGA


>TTHERM_00624190(protein)
MIKGQKDSNFYSLNQRANISNQTRQTIIKSSQERNRNRNSRTESNHMRQQNSIQQIQDWK
NHPIGRLYIEGMTSNLVNHQSANKVLDLNGNADNYTLNVQKIENDINSMIKSANNDYIDG
QNDGKQFNDSNQINTNEQRILQQQQNVQNVQGNPMVYNKNVLQGGISYRIKKKNDNQIRA
VTNSSLDQRNLNYTQNMIQQLQSSLIQDQITQRDNSLQKSSNPDIIQSQIISSPEKMPYP
YRKREYSADSRNQYQQQFNEAKNFFQNQQAAQQLSNYNALNNSLNQQTYHPNLLTIGAQK
INYQQNQSQLHNNGSTKSFNQSPPVHGIKNLDKSYMSASPEWQNQQQQYQQNQQGANPYQ
IPQNKMQNIIKEMRFPQSPINSIHNQHSRLYDYNQGYSQNLNGYTTQEDRNKILKKILAH
FNVKVQQMERKQFMNIFGLEIKQIPPQDISKSHRLNANQAYYNSLNTKRQQKINNLSEMI
NSNLAENRQNVNLRNNKQMAAGSNKLNQTMNNGQQGLVDKRQAYRSNSSDQQLILSGIAE
MNEQASSPMGKDKLFGFNENNNQQERYDQNGNLIQQSLTPGNNPNEQQNDYYEQKNSQPS
SESESTKESNGQVNGLSNNNQSNLQGLNQQDRVNTPSGGGQNRKRINQSLNSRPSNQAMM
MVRRLPKNNGNKNFQFSMNDNNLQREEIFFKKFNTYKDFIFKINFGSHYFVTMPQENPIY
KICVGRGNNSKLIKNCIKNRWWWQVLDYDQHLECNFLWTQCKVQPFFDKQENLDPPHTEE
DINKDDYISPEFQISRAKVVFQEVDGKDSPDDMNQTSRVFNKLQSSPDKRFNQKQNQNNN
SSNQGNGSNTAAFKGGVNDAKQNGSSINKQANPFPQYSDHNLKIFSQQDYQMYYKYMNSQ
PGQRDYYIQNWDDLSFRLKNLKRTNIDKPYKILENSQKQITHNHLQFNYMLGNKKALFYN
MRQYYQLMKDDVFNYLPLTYHLTRGTEDKEFRNFLKKFKEIENSNNDNDESKKSQKKMKN
VWIVKPGEITNRGNGIQVCDNLNDIKRILTSKEKHNNGKDKTYIVQKYIERPFLYNRRKF
DIRAYMLITCINGVLRGYWYQEGYIRTSGREFDLSDVSDVFIHLTNDAIQKDCEEYNKFE
PGNKLSYFEFQRYLDIWYSDQKYNLYSQILPKMKAIATDSIRATFLKLDPQRKQNNFEVF
GLDFMIDDKFKPYLIEINTNPAIETTCPICLRVIPGMIENAFRIGLDPLFPPPQNWPGQK
KHLAPDSLTEHNRFEIIFDEQYDGIELKRLYKNQENCLEGMNDLDEDEEIDDEKSNKDKD
EDKEIEYD


>TTHERM_00624190(gene)
TTCAATAATAACAGATATATTATGATAAAAGGTTAAAAAGATAGTAACTTTTACTCTTTA
AATTAAAGGGCGAATATTTCTAACCAAACGTAAATTGCATAAAGCTTTTTAAATAATAAT
TTTATTTGCTTAGTCCTTTATTGACAAATTCTTAAAGGCATATTAATATATATTTAGGCG
CTAGACTATCATAAAAAGTAGTTAAGAGAGGAATAGAAATAGGAATTCAAGGACTGAGAG
CAATCACATGAGATAGTAAAATTCAATATAGCAAATTTAAGATTGGAAAAGTAAATTATT
TTTTTTAGTTCTAATTGTTACCAAATAAAATTAATCTATTAATAGACCATCCAATAGGCC
GTCTTTATATTGGTAAAGCATTTATACTATTTGCTTTATAAGAGATTACTAAATTTGATA
TAAAAATATGAATTAGCAATTTTAATCAATTCTTTTTGTAAATAAATAAATAGAAGGAAT
GACAAGTAATTTAGTAAATCATTAAAGTGCCAATAAAGTATTAGATTTAGTAATTAATAC
ATTTTAATTTACTAGTTCGCCTAGCTAATTAACTAATTAAATAACTTATCATTTTATTTA
TTTAAAAAATAGAATGGAAATGCTGATAACTATACTTTAAATGTTTAAAAGATAGAAAAT
GATATAAATAGCATGATTAAGAGTGCGAATAATGATTATATTGATGGATAAAGTAAAATT
TCTTTTTAAAAAGTAAAATCTTCAATTGATTTTTTTTGTTTTATAGACGATGGAAAGTAA
TTTAATGATTCTAACTAAATAAATACTAATGAATAGAGAATACTATAATAGCAATAAAAT
GTTTAGAATGTTTAAGGGAATCCTATGGTTTATAATAAAAATGTTCTCTAAGGAGGAATA
TCATATAGGATTAAAAAGAAAAATGATAACCAGATTCGAGGTAATTTAAAAATAGAACTT
TTATATAAAAATTGTTAATTTTTCAATGTTCATAAGAACATAAAATTAGGAAAAAGTATT
AAATTTATTTTTCATGAAAAACTAACAATTTAAATGTAAACTTATGATTAAAATTTTGAA
AATATTTTGTTTATTATATTAGCAGTGACAAATAGTAGTCTCGATTAAAGAAACTTAAAT
TATACTTAGAATATGATTTAGTAATTATAAAGTTCATTAATATAAGGTAAATTTATTTTA
AACCATCCTTTTTATGATTTTGAAATATAAAAAAATAATTTATACTTTTATTTTTTACTA
AAAAAGACTAAATTACTTAAAGGGATAATTCATTACAAAAGAGCAGTAATCCAGATATTA
TTTAAAGCTAAATAATTAGTAGTCCTGAAAAAATGCCATATCCTTACAGAAAAAGAGAAT
ACTCAGCAGATAGTAGAAATCAGTACTAATAATAATTTAATGAAGCAAAAAACTTCTTTT
AAAATTAACAAGCAGCTTAATAGTTAAGCAATTATAATGCTCTAAATAATAGCTTAAATT
AGTAAACTTATCATCCAAATCTCTTAACTATTGGAGCTTAGAAAATTAACTATCAGTAAA
ATTAATCATAACTCCATAACAATGGATCAACTAAAAGCTTTAACTAATCACCTCCAGTCC
ATGGTATTAAAAATTTAGATAAATCTTATATGTCAGCTTCTCCTGAGTGGTAAAATTAAC
AGTAGTAATACTAGCAGAATTAGTAAGGAGCAAATCCATATTAAATTCCTTAAAATAAAA
TGCAAAATATTATTAAAGAAATGAGATTTCCTTAGAGTCCTATTAATTCAATACACAATT
AGCACAGTCGACTTTACGATTACAACTAAGGTTATAGCTAAAATTTAAATGGGTACACAA
CTTAAGAAGATCGAAATAAAATACTTAAAAAAATATTAGCTCACTTTAATGTTAAAGTGC
AGTAAATGGAAAGAAAATAATTCATGAATATTTTTGGTTTGGAAATTAAATAGATACCAC
CTTAAGATATTAGTAAATCTCATAGATTGAATGCTAATCAAGCTTATTACAATAGTTTGA
ACACCAAAAGATAGTAAAAAATAAATAATCTTTCAGAAATGATAAATAGCAATTTAGCTG
AGAATAGGCAAAATGTTAATTTAAGAAATAATAAACAGATGGCTGCAGGTTCTAATAAGC
TTAATCAGACAATGAATAATGGACAACAGGGTTTAGTTGATAAAAGATAAGCGTATAGAA
GCAATAGCTCAGATCAATAGTTAATTTTAAGTGGTATTGCTGAAATGAATGAGTAAGCTA
GCTCTCCTATGGGAAAAGACAAATTATTTGGATTTAATGAAAACAATAATTAGCAAGAAA
GATATGATCAAAATGGAAATTTGATATAACAATCTCTGACTCCAGGAAATAATCCAAACG
AATAACAAAATGATTACTATGAACAAAAAAATAGCTAACCTTCAAGCGAATCTGAGTCTA
CCAAAGAATCAAATGGTTAAGTGAATGGATTATCTAACAACAATCAAAGTAACTTATAAG
GATTAAATTAATAAGATAGGGTAAATACTCCTTCAGGAGGAGGTTAAAATAGAAAAAGAA
TTAACTAATCCTTGAATTCTCGTCCAAGTAATTAGGCGATGATGATGGTAAGAAGATTAC
CAAAAAATAATGGAAATAAAAACTTTTAATTCTCTATGAACGATAACAATCTTTAACGTG
AAGAAATATTCTTTAAAAAGTTTAACACCTATAAAGATTTTATATTTAAAATTAATTTTG
GCAGTCATTACTTTGTTACAATGCCACAAGAAAATCCAATTTATAAAATCTGTGTTGGGC
GTGGAAATAACAGTAAATTGATAAAAAATTGCATCAAAAATAGATGGTGGTGGCAAGTCT
TAGATTATGATTAGCACCTCGAGTGCAACTTCCTTTGGACCTAATGTAAAGTATAACCAT
TCTTCGATAAATAGGAAAACTTAGATCCTCCACACACTGAAGAGGATATCAATAAAGATG
ATTACATATCTCCTGAATTTCAAATTAGTAGAGCAAAAGTTGTGTTTCAAGAAGTTGATG
GTAAAGATTCTCCTGATGATATGAATTAAACAAGTAGAGTTTTCAACAAGCTACAAAGTT
CCCCTGATAAAAGATTCAATTAAAAGCAAAATCAAAACAACAATAGCAGTAATTAAGGAA
ATGGTAGTAATACTGCTGCTTTTAAAGGAGGAGTAAATGATGCTAAGTAAAATGGTAGCT
CTATTAATAAGTAAGCCAACCCCTTCCCACAATATTCTGATCACAACTTAAAAATATTCT
CATAGTAAGACTATCAGATGTATTATAAATATATGAATAGCTAGCCAGGCTAAAGAGATT
ATTATATTTAAAATTGGGATGATTTAAGTTTTCGTCTTAAAAATTTAAAAAGAACAAATA
TTGATAAGCCCTATAAAATTCTTGAAAATAGTTAAAAATAAATTACTCATAATCATTTGT
AATTTAATTACATGTTAGGAAATAAAAAGGCATTATTCTATAACATGAGACAATATTATC
AACTCATGAAAGATGATGTTTTTAATTATCTCCCTTTAACTTACCATTTAACTAGAGGAA
CAGAAGATAAAGAATTCAGAAATTTCTTAAAGAAATTTAAAGAGATAGAGAACTCTAATA
ATGATAATGATGAGTCTAAGAAGTCTTAGAAAAAGATGAAAAATGTCTGGATTGTTAAGC
CAGGAGAAATCACTAATAGAGGTAATTTTTTACTATATTTTTTTTTAAGTTAAATCATTT
TGTTATAAAATTATAGGAAATGGTATACAAGTCTGTGATAATTTAAATGATATAAAGCGT
ATATTAACAAGTAAAGAAAAGCATAATAATGGAAAAGATAAAACATATATAGTCTAGAAA
TATATTGAAAGACCTTTCCTCTATAACAGAAGAAAGTTCGATATTAGAGCATACATGCTT
ATTACTTGCATTAATGGAGTTCTCAGAGGTTATTGGTATTAAGAAGGTTACATCAGAACT
AGTGGAAGAGAATTTGACCTTTCAGATGTTTCTGACGTATTCATTCATCTAACAAATGAT
GCTATATAAAAAGATTGTGAAGAATATAATAAGTTTGAACCAGGAAATAAATTATCATAT
TTTGAATTTTAGAGATATTTGGATATATGGTATTCTGATTAAAAGTATAACCTTTACTCT
TAAATTTTACCGAAAATGAAAGCAATAGCTACCGATTCTATCAGAGCTACTTTTCTAAAG
TTAGACCCACAAAGAAAGCAGAATAATTTTGAAGTAATAAATAAATTTATACTTTATTAG
AGTTTAGAATTTTATTTTTATTTTTAAAATAGGTTTTTGGTTTAGATTTTATGATTGACG
ATAAATTTAAACCCTATTTGATAGAAATAAATACTAACCCAGCTATAGAAACAACATGTC
CAATATGCTTAAGAGTTATACCTGGAATGATTGAAAATGCTTTTAGGTAATTAATTGTAA
ATATTATATTAATTTTAATTAAAAAATTATCAAAATAGAATTGGTCTTGACCCTTTATTC
CCTCCTCCACAAAATTGGCCAGGATAAAAAAAGCATTTAGCCCCAGATTCATTAACTGAG
CATAATAGATTTGAAATTATATTTGATGAATAATACGATGGAATAGAATTAAAAAGACTC
TATAAAAACCAAGAAAATTGTCGTAAATAAATATATTTAATTAATTTTTTGAATAATAAT
CATTCTTACTTAATTTAATACAAATAGTTGAAGGAATGAATGATCTTGATGAAGATGAGG
AAATTGACGATGAAAAGAGTAACAAGGATAAGGATGAAGATAAAGAAATTGAATATGACT
GA