Identifiers and Description

Gene Model Identifier

TTHERM_01109810

Standard Name

TTLL10E (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt17951 | 239.m00030 | 3802.m00171

Description

Related to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_01109810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20533.19.997093137033517e-262hypothetical protein (524 aa)
OxytrichaContig19078.0.g263.999970367130025e-21TPR repeat
DictyBaseDDB_G02691940.00000000000001000191320216021trfA on chromosome: 1 position
3020703 to 3025206
WormBaseWBGene000038580.0000000000008001317446409227locus:ogt-1 UDP-N-acetylgluc
osamine--peptide N-acetylgluco
saminyltransferase status:Co
nfirmed UniProt:O18158 pro
tein_id:CCD61614.1
SGDYBL084C0.000000000029994712494008525CDC27 Subunit of the Anaphase-
Promoting Complex/Cyclosome (A
PC/C), which is a ubiquitin-pr
otein ligase required for degr
adation of anaphase inhibitors
, including mitotic cyclins, d
uring the metaphase/anaphase t
ransition

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_01109810(coding)
ATGAGTGTACTTTTAAGAAAAAATATATTCCTTAATGTTAACTAACTACAATTTTTCGAT
ATTAAAAATGTTTAGCGCTTTAATAAAATGTTTAGATTTAACAATAGCTTAATAAATAAA
TATCTGAAAACATTTATAAAGTTTACAACTTTAGGATCTTTGCCATTGTTATTCAATTAT
TTTTAAGATAATATTAAAATGATTAGTAATGAACAAGATTATGTATTATCAGATAAATTT
ACTGAACAAGAGTTAAAAGAACTAGAAAAAACAGTTGAAAGAAACCCAAAAAACATTTAA
ATGAAGTATAAGTTATTAAATTAATATTTTATTCTGAATAAACTAGATAAAGCAGAAAAG
CTATTAAAAATTCTAATTTAAGAAGACAAGTAAAGCCATAAACCTTATGTGTACCTAGGA
TCACTCTACATAAAATAAGAAAAATAATAAGAAGCCATTCAAATTCTTAATACAGCCATT
AAGCACTTTCCTAAGTGCTAAGAAGCATATTTACTGATTGCTTCAATTTATAATAAGAAT
GGTAATAAAGTGAAAGCAGTAGAAACTTTTAAAAAATACATTGAATAGGATCCTAAAAAT
TCTTCTATTTATAATGATTTAGGAAATTATTATATTGAGTAATTTAATGATTATGAGAAA
GCTTAAAATGTTTACGAAGAAGGAATAAAATAAGTTGGAAATGATCCTTAATTACTATGC
AATGTTGGCAAAGTTTATTTGTAAAAGTAAAATTTCGAGGAAGCAAGAAAATACTTTGAA
CAAACTATAGCCATTTCAAAAGAAATATATTTTGCTTTTATTTACTTGGGAGTCGTAAAC
TTAAAAGAAGATAAGTTTGAAGAAGCAGCAGAGAATTTTGAAAGAGCTATGAAGTTAGAC
CCATAAAAACCTCTTTCATATAAAAATTTGTGCAATATGTATTTTAACAAAAAAGATTTT
AAGAAATCACTACATTATAGTAATAAATGGGATAGTGTAGAATCTTCTTCAGCATGGAAT
TTATCACACAAAGCTTAATGTTATATATAAATGGAACAATTTGATAAAGCTATTGAAGTT
TTATAGAAAGCCACAGACATTGAACCTAAAAATGACGATAATTATTTTTATTTAAGCTAT
TCTTATGACAAAATAAACAAGCATGAAGAGGCCTTAAAATATATTTAAAAATGCATAGAA
TTGAATCCAAATGATCCATAATCTTTTTATTAATAAACAGTATATTTACTGAAATTAAAA
AAGTATAATGAAGCTATTTAGAGTGCTGAATAAGAAATTAAATTAGATCCTAGATCTGAA
TAAGCTTATAGATGTATTGGAGATGCATTTTTTGCTTAAAAAGATTTTATGCAAGCTATA
GATGCTTACGAAATATATCTTTAGTTGAAAGAAGATCCTATTATAAAAATAAAGCTAGCT
AATTCTTTTTACATGATAAAATAATATCAATAAGCATTGGAATTATACAAAGAAGCAGCT
ATGATAGAGCCTAAAACAGTCTTAAAAAACTATTAATTTATCTTATCTTCACTAAAAAAT
ATGATTTTAGGATGA


>TTHERM_01109810(protein)
MSVLLRKNIFLNVNQLQFFDIKNVQRFNKMFRFNNSLINKYLKTFIKFTTLGSLPLLFNY
FQDNIKMISNEQDYVLSDKFTEQELKELEKTVERNPKNIQMKYKLLNQYFILNKLDKAEK
LLKILIQEDKQSHKPYVYLGSLYIKQEKQQEAIQILNTAIKHFPKCQEAYLLIASIYNKN
GNKVKAVETFKKYIEQDPKNSSIYNDLGNYYIEQFNDYEKAQNVYEEGIKQVGNDPQLLC
NVGKVYLQKQNFEEARKYFEQTIAISKEIYFAFIYLGVVNLKEDKFEEAAENFERAMKLD
PQKPLSYKNLCNMYFNKKDFKKSLHYSNKWDSVESSSAWNLSHKAQCYIQMEQFDKAIEV
LQKATDIEPKNDDNYFYLSYSYDKINKHEEALKYIQKCIELNPNDPQSFYQQTVYLLKLK
KYNEAIQSAEQEIKLDPRSEQAYRCIGDAFFAQKDFMQAIDAYEIYLQLKEDPIIKIKLA
NSFYMIKQYQQALELYKEAAMIEPKTVLKNYQFILSSLKNMILG


>TTHERM_01109810(gene)
TTAATAAATTAGATAGAATATTCTTATATCCCATAAAAAAGCAAAAAAAATAATAAAAAA
ATGAGTGTACTTTTAAGAAAAAATATATTCCTTAATGTTAACTAACTACAATTTTTCGAT
ATTAAAAATGTTTAGCGCTTTAATAAAATGTTTAGATTTAACAATAGCTTAATAAATAAA
TATCTGAAAACATTTATAAAGTTTACAACTTTAGGATCTTTGCCATTGTTATTCAATTAT
TTTTAAGATAATATTAAAATGATTAGTAATGAACAAGATTATGTATTATCAGATAAATTT
ACTGAACAAGAGTTAAAAGAACTAGAAAAAACAGTTGAAAGAAACCCAAAAAACATTTAA
ATGAAGTATAAGTTATTAAATTAATATTTTATTCTGAATAAACTAGATAAAGCAGAAAAG
CTATTAAAAATTCTAATTTAAGAAGACAAGTAAAGCCATAAACCTTATGTGTACCTAGGA
TCACTCTACATAAAATAAGAAAAATAATAAGAAGCCATTCAAATTCTTAATACAGCCATT
AAGCACTTTCCTAAGTGCTAAGAAGCATATTTACTGATTGCTTCAATTTATAATAAGAAT
GGTAATAAAGTGAAAGCAGTAGAAACTTTTAAAAAATACATTGAATAGGATCCTAAAAAT
TCTTCTATTTATAATGATTTAGGAAATTATTATATTGAGTAATTTAATGATTATGAGAAA
GCTTAAAATGTTTACGAAGAAGGAATAAAATAAGTTGGAAATGATCCTTAATTACTATGC
AATGTTGGCAAAGTTTATTTGTAAAAGTAAAATTTCGAGGAAGCAAGAAAATACTTTGAA
CAAACTATAGCCATTTCAAAAGAAATATATTTTGCTTTTATTTACTTGGGAGTCGTAAAC
TTAAAAGAAGATAAGTTTGAAGAAGCAGCAGAGAATTTTGAAAGAGCTATGAAGTTAGAC
CCATAAAAACCTCTTTCATATAAAAATTTGTGCAATATGTATTTTAACAAAAAAGATTTT
AAGAAATCACTACATTATAGTAATAAATGGGATAGTGTAGAATCTTCTTCAGCATGGAAT
TTATCACACAAAGCTTAATGTTATATATAAATGGAACAATTTGATAAAGCTATTGAAGTT
TTATAGAAAGCCACAGACATTGAACCTAAAAATGACGATAATTATTTTTATTTAAGCTAT
TCTTATGACAAAATAAACAAGCATGAAGAGGCCTTAAAATATATTTAAAAATGCATAGAA
TTGAATCCAAATGATCCATAATCTTTTTATTAATAAACAGTATATTTACTGAAATTAAAA
AAGTATAATGAAGCTATTTAGAGTGCTGAATAAGAAATTAAATTAGATCCTAGATCTGAA
TAAGCTTATAGATGTATTGGAGATGCATTTTTTGCTTAAAAAGATTTTATGCAAGCTATA
GATGCTTACGAAATATATCTTTAGTTGAAAGAAGATCCTATTATAAAAATAAAGCTAGCT
AATTCTTTTTACATGATAAAATAATATCAATAAGCATTGGAATTATACAAAGAAGCAGCT
ATGATAGAGCCTAAAACAGTCTTAAAAAACTATTAATTTATCTTATCTTCACTAAAAAAT
ATGATTTTAGGATGATTATATACAATTTATTGC