Identifiers and Description

Gene Model Identifier

TTHERM_01109810

Standard Name

TTLL10E (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt17951 | 239.m00030 | 3802.m00171

Description

TTLL10E tubulin-tyrosine ligase family protein; Related to tubulin tyrosine ligase

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 13.9%

TetraMine Data

TTHERM_01109810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20533.19.997093137033517e-262hypothetical protein (524 aa)
OxytrichaContig19078.0.g263.999970367130025e-21TPR repeat
DictyBaseDDB_G02691940.00000000000001000191320216021trfA on chromosome: 1 position
3020703 to 3025206
WormBaseWBGene000038580.0000000000008001317446409227locus:ogt-1 UDP-N-acetylgluc
osamine--peptide N-acetylgluco
saminyltransferase status:Co
nfirmed UniProt:O18158 pro
tein_id:CCD61614.1
SGDYBL084C0.000000000029994712494008525CDC27 Subunit of the Anaphase-
Promoting Complex/Cyclosome (A
PC/C), which is a ubiquitin-pr
otein ligase required for degr
adation of anaphase inhibitors
, including mitotic cyclins, d
uring the metaphase/anaphase t
ransition

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_01109810(coding)
ATGAGTGTACTTTTAAGAAAAAATATATTCCTTAATGTTAACTAACTACAATTTTTCGAT
ATTAAAAATGTTTAGCGCTTTAATAAAATGTTTAGATTTAACAATAGCTTAATAAATAAA
TATCTGAAAACATTTATAAAGTTTACAACTTTAGGATCTTTGCCATTGTTATTCAATTAT
TTTTAAGATAATATTAAAATGATTAGTAATGAACAAGATTATGTATTATCAGATAAATTT
ACTGAACAAGAGTTAAAAGAACTAGAAAAAACAGTTGAAAGAAACCCAAAAAACATTTAA
ATGAAGTATAAGTTATTAAATTAATATTTTATTCTGAATAAACTAGATAAAGCAGAAAAG
CTATTAAAAATTCTAATTTAAGAAGACAAGTAAAGCCATAAACCTTATGTGTACCTAGGA
TCACTCTACATAAAATAAGAAAAATAATAAGAAGCCATTCAAATTCTTAATACAGCCATT
AAGCACTTTCCTAAGTGCTAAGAAGCATATTTACTGATTGCTTCAATTTATAATAAGAAT
GGTAATAAAGTGAAAGCAGTAGAAACTTTTAAAAAATACATTGAATAGGATCCTAAAAAT
TCTTCTATTTATAATGATTTAGGAAATTATTATATTGAGTAATTTAATGATTATGAGAAA
GCTTAAAATGTTTACGAAGAAGGAATAAAATAAGTTGGAAATGATCCTTAATTACTATGC
AATGTTGGCAAAGTTTATTTGTAAAAGTAAAATTTCGAGGAAGCAAGAAAATACTTTGAA
CAAACTATAGCCATTTCAAAAGAAATATATTTTGCTTTTATTTACTTGGGAGTCGTAAAC
TTAAAAGAAGATAAGTTTGAAGAAGCAGCAGAGAATTTTGAAAGAGCTATGAAGTTAGAC
CCATAAAAACCTCTTTCATATAAAAATTTGTGCAATATGTATTTTAACAAAAAAGATTTT
AAGAAATCACTACATTATAGTAATAAATGGGATAGTGTAGAATCTTCTTCAGCATGGAAT
TTATCACACAAAGCTTAATGTTATATATAAATGGAACAATTTGATAAAGCTATTGAAGTT
TTATAGAAAGCCACAGACATTGAACCTAAAAATGACGATAATTATTTTTATTTAAGCTAT
TCTTATGACAAAATAAACAAGCATGAAGAGGCCTTAAAATATATTTAAAAATGCATAGAA
TTGAATCCAAATGATCCATAATCTTTTTATTAATAAACAGTATATTTACTGAAATTAAAA
AAGTATAATGAAGCTATTTAGAGTGCTGAATAAGAAATTAAATTAGATCCTAGATCTGAA
TAAGCTTATAGATGTATTGGAGATGCATTTTTTGCTTAAAAAGATTTTATGCAAGCTATA
GATGCTTACGAAATATATCTTTAGTTGAAAGAAGATCCTATTATAAAAATAAAGCTAGCT
AATTCTTTTTACATGATAAAATAATATCAATAAGCATTGGAATTATACAAAGAAGCAGCT
ATGATAGAGCCTAAAACAGTCTTAAAAAACTATTAATTTATCTTATCTTCACTAAAAAAT
ATGATTTTAGGATGA


>TTHERM_01109810(protein)
MSVLLRKNIFLNVNQLQFFDIKNVQRFNKMFRFNNSLINKYLKTFIKFTTLGSLPLLFNY
FQDNIKMISNEQDYVLSDKFTEQELKELEKTVERNPKNIQMKYKLLNQYFILNKLDKAEK
LLKILIQEDKQSHKPYVYLGSLYIKQEKQQEAIQILNTAIKHFPKCQEAYLLIASIYNKN
GNKVKAVETFKKYIEQDPKNSSIYNDLGNYYIEQFNDYEKAQNVYEEGIKQVGNDPQLLC
NVGKVYLQKQNFEEARKYFEQTIAISKEIYFAFIYLGVVNLKEDKFEEAAENFERAMKLD
PQKPLSYKNLCNMYFNKKDFKKSLHYSNKWDSVESSSAWNLSHKAQCYIQMEQFDKAIEV
LQKATDIEPKNDDNYFYLSYSYDKINKHEEALKYIQKCIELNPNDPQSFYQQTVYLLKLK
KYNEAIQSAEQEIKLDPRSEQAYRCIGDAFFAQKDFMQAIDAYEIYLQLKEDPIIKIKLA
NSFYMIKQYQQALELYKEAAMIEPKTVLKNYQFILSSLKNMILG


>TTHERM_01109810(gene)
ATGAGTGTACTTTTAAGAAAAAATATATTCCTTAATGTTAACTAACTACAATTTTTCGAT
ATTAAAAATGTTTAGCGCTTTAATAAAATGTTTAGATTTAACAATAGCTTAATAAATAAA
TATCTGAAAACATTTATAAAGTTTACAACTTTAGGATCTTTGCCATTGTTATTCAATTAT
TTTTAAGATAATATTAAAATGATTAGTAATGAACAAGATTATGTATTATCAGATAAATTT
ACTGAACAAGAGTTAAAAGAACTAGAAAAAACAGTTGAAAGAAACCCAAAAAACATTTAA
ATGAAGTATAAGTTATTAAATTAATATTTTATTCTGAATAAACTAGATAAAGCAGAAAAG
CTATTAAAAATTCTAATTTAAGAAGACAAGTAAAGCCATAAACCTTATGTGTACCTAGGA
TCACTCTACATAAAATAAGAAAAATAATAAGAAGCCATTCAAATTCTTAATACAGCCATT
AAGCACTTTCCTAAGTGCTAAGAAGCATATTTACTGATTGCTTCAATTTATAATAAGAAT
GGTAATAAAGTGAAAGCAGTAGAAACTTTTAAAAAATACATTGAATAGGATCCTAAAAAT
TCTTCTATTTATAATGATTTAGGAAATTATTATATTGAGTAATTTAATGATTATGAGAAA
GCTTAAAATGTTTACGAAGAAGGAATAAAATAAGTTGGAAATGATCCTTAATTACTATGC
AATGTTGGCAAAGTTTATTTGTAAAAGTAAAATTTCGAGGAAGCAAGAAAATACTTTGAA
CAAACTATAGCCATTTCAAAAGAAATATATTTTGCTTTTATTTACTTGGGAGTCGTAAAC
TTAAAAGAAGATAAGTTTGAAGAAGCAGCAGAGAATTTTGAAAGAGCTATGAAGTTAGAC
CCATAAAAACCTCTTTCATATAAAAATTTGTGCAATATGTATTTTAACAAAAAAGATTTT
AAGAAATCACTACATTATAGTAATAAATGGGATAGTGTAGAATCTTCTTCAGCATGGAAT
TTATCACACAAAGCTTAATGTTATATATAAATGGAACAATTTGATAAAGCTATTGAAGTT
TTATAGAAAGCCACAGACATTGAACCTAAAAATGACGATAATTATTTTTATTTAAGCTAT
TCTTATGACAAAATAAACAAGCATGAAGAGGCCTTAAAATATATTTAAAAATGCATAGAA
TTGAATCCAAATGATCCATAATCTTTTTATTAATAAACAGTATATTTACTGAAATTAAAA
AAGTATAATGAAGCTATTTAGAGTGCTGAATAAGAAATTAAATTAGATCCTAGATCTGAA
TAAGCTTATAGATGTATTGGAGATGCATTTTTTGCTTAAAAAGATTTTATGCAAGCTATA
GATGCTTACGAAATATATCTTTAGTTGAAAGAAGATCCTATTATAAAAATAAAGCTAGCT
AATTCTTTTTACATGATAAAATAATATCAATAAGCATTGGAATTATACAAAGAAGCAGCT
ATGATAGAGCCTAAAACAGTCTTAAAAAACTATTAATTTATCTTATCTTCACTAAAAAAT
ATGATTTTAGGATGA