Identifiers and Description

Gene Model Identifier

TTHERM_00136210

Standard Name

TTLL1 (Tubulin Tyrosine Ligase-Like )

Aliases

PreTt24346 | 10.m00395 | 3698.m00114

Description

Tubulin polyglutamylase; specificity for alpha-tubulin in vitro; knockout shows reduced tubulin polyglutamylation in basal bodies; localizes to subset of MT-rich structures, incl. basal bodies, contractile vacuole pore, deep fiber

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF03133 ) Tubulin-tyrosine ligase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00136210

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_120840
Tetrahymena borealisEI9_05787.19.997093137033517e-262tubulin-tyrosine ligase (412 a
a)
OxytrichaContig19772.0.0.g732.0002969069156684e-168Tubulin-tyrosine ligase family
WormBaseWBGene000441879.001701800865775e-93locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
DictyBaseDDB_G02815413.0007793728221555e-22DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
SGDYBR094W0.00000000000004998767099442072PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:15890843: Janke C, Rogowski K, Wloga D, Regnard C, Kajava AV, Strub JM, Temurak N, van Dijk J, Boucher D, van Dorsselaer A, Suryavanshi S, Gaertig J, Eddé B (2005) Tubulin polyglutamylase enzymes are members of the TTL domain protein family. Science (New York, N.Y.) 308(5729):1758-62

Sequences

>TTHERM_00136210(coding)
ATGGCTTCTAAAAAATTAAAATACAAGACAGATTTTGACAAATGTGTTTTAACAGATAAT
TTTGCTGCAAGAGGATGGACTAGATGTGGTGATAAAGATGACGATGATTGGAACATTTAT
TGGGCAACTGTATGGAATGTGAGAAATATTTTCAATCCTAAATCAGGAATTAGATTAAAT
GATATGCAAATTATAAATCATTTCCCAAATCATTATGAATTGACAAGAAAAGATCTTATG
GTAAAAAACTTCAAGAGATATAAAAAAGAATTAGAAAAAGAGAATAGTCCTTATTGCTAG
AAAGACGAAAATGGAAATTATCTATATTTAGATTTTATTCCATAAACATTTACTCTTCCT
GGTGAGTATTCACTCTTTGTTGAAGAATTTCATAGAAATCCTAATGCAACTTGGATTGTT
AAACCAGCATCACGATCTCAAGGAAAAGGTATTTTCTTGCTTAGAAAAATACAGCAGTTG
AAGAAAATAGGAGGAGGAACTAATAGCAATCCTCTGCAGGCATTTTCTCTAAAAGAAGCT
TATGTTGTTTCTAGATATATAGATAATCCATTGCTTGTTGGAGGGAGAAAATTCGATTTA
AGAATATATGCTCTTGTTACCTCTTATCGTCCTCTTAAGGTTTATTTATACGCTATGGGA
TTCGGTCGTTTTTGTAATGAATAGTATACTCAAGATATTGCTGAAATGGATAATATGTTT
ATTCACTTAACAAATGTTGCTATTTAAAAGTTCTCAGATAAGTATTCTGAAAAACACGGA
GGAAAATGGTCATTACAGTCTTTAAGGTATTATCTAGAAATGGTTTATGGTACAGATATG
GCTAATAAATGTTTTGATGATATAAACAATATAATTATAATGAGTTTGAAATCTGTTTAA
AGTATAATAATAAATGATAAGCACTGTTTTGAGATGTATGGCTATGATATATTAATTGAT
GAAAACTGCAAACCATGGCTTATTGAAATAAATGCTTCTCCCTCTTTAACTGTTACAGGT
AAAATTGATAAAGAACTCAAAACTGAACTGATTAAAAATGTATATTAAATTGTCATTCCT
GATGATTGGAATGATGATAGTTCTAAAACTGGTGCAAACACTAGCACATAAACAAAAGTT
GGAGATTTTAATATTCTATATGATGAGGCCTAAGAAAAGAAAATTAGTTAGTAATAATAA
TAATAAAAAAAGAATATAAATAGTAAAACAATTTGGAAATGA


>TTHERM_00136210(protein)
MASKKLKYKTDFDKCVLTDNFAARGWTRCGDKDDDDWNIYWATVWNVRNIFNPKSGIRLN
DMQIINHFPNHYELTRKDLMVKNFKRYKKELEKENSPYCQKDENGNYLYLDFIPQTFTLP
GEYSLFVEEFHRNPNATWIVKPASRSQGKGIFLLRKIQQLKKIGGGTNSNPLQAFSLKEA
YVVSRYIDNPLLVGGRKFDLRIYALVTSYRPLKVYLYAMGFGRFCNEQYTQDIAEMDNMF
IHLTNVAIQKFSDKYSEKHGGKWSLQSLRYYLEMVYGTDMANKCFDDINNIIIMSLKSVQ
SIIINDKHCFEMYGYDILIDENCKPWLIEINASPSLTVTGKIDKELKTELIKNVYQIVIP
DDWNDDSSKTGANTSTQTKVGDFNILYDEAQEKKISQQQQQQKKNINSKTIWK


>TTHERM_00136210(gene)
ATGGCTTCTAAAAAATTAAAATACAAGACAGATTTTGACAAATGTGTTTTAACAGATAAT
TTTGCTGCAAGAGGATGGACTAGGTAATTAAAAATTACTAACATTCTATTCATTTTTATT
TAATTCAATCCAAATATTAAAACTTATTTTTATAAAGATGTGGTGATAAAGATGACGATG
ATTGGAACATTTATTGGGCAACTGTATGGAATGTGAGAAATATTTTCAATCCTAAATCAG
GTAGGCTGACTAAATTTATTATAAAATACTACATACTATTCCTTAAATACTATTATAACT
TTTATACTTCTTTTTAGATAGCTAAGTTGTTTCTAAATCAGATTTTTTATTCTTACAAAA
AAATTTATAAAAACTAGGAATTAGATTAAATGATATGCAAATTATAAATCATTTCCCAAA
TCATTATGAATTGACAAGAAAAGATCTTATGGTAAAAAACTTCAAGAGATATAAAAAAGA
ATTAGAAAAAGAGAATAGTCCTTATTGCTAGAAAGACGAAAATGGAAATTATCTATATTT
AGATTTTATTCCATAAACATTTACTCTTCCTGGTGAGTATTCACTCTTTGTTGAAGAATT
TCATAGAAATCCTAATGCAACTTGGATTGTTAAACCAGCATCACGATCTCAAGGAAAAGG
TATTTTCTTGCTTAGAAAAATACAGCAGTTGAAGAAAATAGGAGGAGGTAATTAATTTTC
TATATATCTATCTTAATAACTTACTAGCAAACTAGCTAATTAATTGACTGATTGATTGAT
TAATTTTGCAAACTAAGATTAGTAATAGAATAAATATCACTTATTGAAAGCAGTAATCAA
TTTAAGTAATTAATATTTCAAAATATTTTATAGGAACTAATAGCAATCCTCTGCAGGCAT
TTTCTCTAAAAGAAGCTTATGTTGTTTCTAGATATATAGATAATCCATTGCTTGTTGGAG
GGAGAAAATTCGATTTAAGAATATATGCTCTTGTTACCTCTTATCGTCCTCTTAAGGTTT
ATTTATACGCTATGGGATTCGGTCGTTTTTGTAATGAATAGTATACTCAAGGTATTATTA
ATTAAAAATATTTTTAGATTGTCAATTAAAATTTTTAAATAGATATTGCTGAAATGGATA
ATATGTTTATTCACTTAACAAATGTTGCTATTTAAAAGTTCTCAGATAAGTATTCTGAAA
AACACGGAGGAAAATGGTCATTACAGTCTTTAAGGTATTATCTAGAAATGGTTTATGGTA
CAGATATGGCTAATAAATGTTTTGATGATATAAACAATATAATTATAATGAGTTTGAAAT
CTGTTTAAAGTATAATAATAAATGATAAGCACTGTTTTGAGATGTATGGCTATGATATAT
TAATTGATGAAAACTGCAAACCATGGCTTATTGAAATAAATGCTTCTCCCTCTTTAACTG
TTACAGGTAAAATAATTAATTTTTTTACCTTCCATATTAAATTCTTTTTATCCTGAAAAA
TCTAATTAAAGGTAAAATTGATAAAGAACTCAAAACTGAACTGATTAAAAATGTATATTA
AATTGTCATTCCTGATGATTGGAATGATGATAGTTCTAAAACTGGTGCAAACACTAGCAC
ATAAACAAAAGTTGGAGATTTTAATATTCTATATGATGAGGCCTAAGAAAAGAAAATTAG
TTAGTAATAATAATAATAAAAAAAGAATATAAATAGTAAAACAATTTGGAAATGA