Identifiers and Description

Gene Model Identifier

TTHERM_00859290

Standard Name

TTL4 (Tubulin-Tyrosine Ligase)

Aliases

PreTt09091 | 152.m00111

Description

Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF06519 ) TolA protein
  • ( PF06623 ) MHC_I C-terminus
  • ( PF03133 ) Tubulin-tyrosine ligase family
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00859290

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_07216.19.997093137033517e-262tubulin-tyrosine ligase (1378
aa)
OxytrichaContig295.1.g763.999582750711782e-108Tubulin-tyrosine ligase family
WormBaseWBGene000142326.002077021906841e-60locus:ttll-4 Tubulin polyglu
tamylase ttll-4 status:Parti
ally_confirmed UniProt:Q0964
7 protein_id:CAA87425.3
Stentor CoeruleusSteCoe_54242.0842828425817514e-52
DictyBaseDDB_G02815411.0002869940498747e-21DDB_G0281541 on chromosome: 3
position 4627625 to 4629265

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00859290(coding)
ATGAATTCAAATCTTACAATTACTAATGGGTAAATTTGCTCCCCTAATCTCACAGGCAAC
GAACTTATATTCATTAAAAGACCAATAATTATCAAAAAGCCTACCAATACCAATAATAAT
TATAACAATATTTAATGTTAAACTAACACTAATGCTAATAATGCTATTCAAAATAGGAGC
ATGATAAACACTTCAAATATTGAACAAAACTATGGATAATCTGCACAAGATAATTTACTA
ACACCTTAATAAAAACAAGCAAATTAATTTTTAACTGATTAAAATAAATCGAAGCACGCT
AAATACCCAAGAGAGTCTAGTCTTCATTCTTCAGGCTAATAGCGAAAGTCATTTGTTATG
GTAACTGAAAAAATTTCAGGAGTAGAAAATAAAGAAATGCTGAATGGAGAATCTCAACTG
TAATATTCTCAGGTCTATAATGTTCAAGCTCATAAAAATATTTAGAAATAGATCATTTCT
CAAAGATATTTAATTAATAATGTTACGCTCAGCAATAATGTTTTGGACGCTAATTTATTA
ATCAAGCGACCTCCTTCTGCGAGTTTAAATTAAAAAAATAAACACTAAATTACTGTGTTT
TAATAGCAGCAGCTATCGTTTTTAAGCAGCTAACAGTAGAATTTATCTAATGGACTTAAT
AAAAAACTAACTATAAACAATATTTAATCAGCATCAGGGCATTAAAGTTAGAATTAAAAG
GGGAATTAAATATCATACAAGTAAAAATAAAAAATTACTAACGACAACTTTAGAAAAGAT
AAAAATGAAAATAATTTTAACAAAAAAGAAGATATCCCATCATATTTTATGGATAACTAT
AATGATGTTAGGCAAGTAGTGTTTTACAAAGACAACAACCCAAGCTACACTTAGAGGCTA
TTGAAAGAAAAGAACGAATAACAGATAGTAGTAAGTTCAAAAACACAAGATGCATATTAG
AGTTCAAGAAATTAAAATAAATATCTCAGCAATTCGACTCTTAGAAAAAAAGACCCTAAC
CTTCTTAGGGAATCTGATGAATTCTAAATGTAAAAAAATTTCCAAGTAAATTATTAGTCA
ATTGAAAAACCTTCGATTCTGAACAAAACGCAATTAACAAATTCTTATTTCATTGATTCA
TCAGTTATTAAATCACCTTTAATGAGTTCATAGAAGAGTAAACAAAACTTAACTACCAGT
TCAAAACAAATTAAAACATATTAACTTGACAAGCTAATGACTAATACAAATCATAAAAAC
TAATTCTAACAAAATAGCTTATCTCCTTATCTCTAACCTAATAATATTGTCAAGAATTAC
GAGACTAACCAAAAGAATTCTAATTCAAATTCTCCTAAAAATTCTAACCGTCTGAGGTAT
TTAGATGATTCTAATGTCCATGATGAAAGAGACGATTAGAGTTTGTAATTATAAAATTCC
TACATAGAAATATTCTCCAGTGATCTTTCCAAATTTAAACAAATTGCTACTAAATTAGAA
CAGTCTTAGCACCCAATAAACGAATAAGAGCACTAAGAAAAATCAAGAAATTCATCAGAT
TCTCTTGATTCTTCAAGAAAAAATCAATAGAGAAAGCATGCTTTAGCGGTAAGCAACATG
CAAATGAATAATGAATAGAAAAAAAATTAATCAGCTTAAAATTAGAAGTAAAAATAATCT
AAACAAAATAAAATTCATGAATTTTAAAAAGAAGCTAAAATTGTAATATAAGAACCACCT
AATAAAGTTTTAAGTTAAAATTAAGAGCACAGAATCTCACAGTTAAGACATAAGCTGCTT
GAAGCTAATGAAAAAGCATTGGCTAGAAAAATATTAGTAAAAAAAAGGTCAATTGCCAAA
CAAAAATCGACAAATCTATGCTCAGTAGATGACAAAAACTGCTCTGATTAAGAAGAGAAT
TAGCAAAAACTTGAATGTGAATAACCTAAAAAAACTACAAAAAGTATAAATAAATAAAAT
AGAATCACTAAAAAAGGTTCTTTAAAGAAATAAGACTCAAATATTATCAGCAGCACATCT
TAAGTAGAGTTATCTCATGTAAAATCTTTAAAAGTAGACAATGAAATTGAAGCTCCTCAG
CAAAAGAGGAAATTTTCTGAAAATAGAGGAACCTCGTAAAAAAGACCCCCACTACCTCTA
TCAACAAATACAAAAAAACAAAAAGAAGGATTTGAAGAAGAAGATGACGATTTTCCCTCT
TTATCAAATCTCTCTGAAATAGAAAATTAATACGACAATTTAGAATTTGAAGATTAAGAA
GAAGATGAAAACCAAAACGACTAAGATTAAAATCAAGAAAAGACCATTTCAAATTCAATG
CATTCTTCAAATAAAGATTAGGTTGGTTCTGCTACTGAATTAGCAGCTAAAAAACAAATT
ATAATAAACAAACCTTTGCCTGTTGTCACCTTATTAAAATCAGTTTACGAAGGAAGACCA
AGCACTATTTTTTTCGAATATCCTGATTGCTGCTTTAAGAAAAGAGAATAAGGTAATCGT
ACGTATATTGCAAATCCGAAAGAAGTAAAGAAATGGAATTTGACATATAGAATGAATGAC
TGTAATCGTCCATACTAATGTGTAACAAAGAGTTTTGAAGCAGGAGGATTTGTAGAAACA
TTATCAAATACATAATGGAATGGGTATTGGGCAAGCAACAGAATCAGCTTCATTAAAAAA
CTAAATAGCTTTTAGAAAACGAATCACTTTGCAGGATGCTGGAATTTAGGAAGAAAAGAT
TAGCTTTGGATGAGAGTTTCAAAATAAAAGAGAAAATTCAATGAGGACTATGATTTTATA
CCAAGGACTATGCTGCTTGGTTAGGAGTGGGATAGATTTAACACGCTTTTAGAAGATAAT
CCTGAAACTCTATGGATAGTCAAGCCAGTAGCTTCTTGTTGTGGCAAAGGAGTGCATGTT
GTTCAAAAAAAATGCAATATTGCCAAGAGAAAACGTAAACACTATTTAGCTAGTGAATAT
ATTTCAAATCCTCATTTGATAAATGATACTAAATATGATTTAAGAATATATGTCTTGGTG
ACTTCTTATGATCCGCTTCGTATTTATATGTTTGAAGATGGTTTAGTGAGATTTGCCACA
GAAAAATATAATTTAACTTAGAATGGACATTAAAGATAAAGATTTATGCATTTAACTAAT
TATAGTGTGAATAAAAAGAGCGAAAATTTTGTTAAAAATAATGATGTGAACGACTCTGGT
TAGGGTTCTAAATGGTCTCTAAAATCTTGGAAGGAATATCTTATTTAAACAATAGGATTA
GAAGCTAAAGAGTAGTTGCTAAAAAAAATGGAAGATGTAATAATTAAAACATGTATCGCA
GTAGAACCTTATATGAATGATAGTTCGAGCAAGACAGCTTAACACAGAAATAATTGCTTC
GAATTATATGGTTTTGACATTTTAATAGACAATACTCTAAAGCCTTGGCTTTTGGAAGTT
AATGTATGTCCATCACTTAGTAGTTCCTCACCATTAGATAGAAAAATTAAGACAAGTCTT
ATAAGCGATATTTTCAATACATTAGGCTTTATACCTTATGATAAAAAGAAGCTCTCTCAG
GAAAAAAAATTTAGCAACAGAAATTAAAAAAAAAAGAAAACGAGATATTCTGTAAATATG
AATAAAGTAATAAAAGAAGAATAAGAATAGGATAATGTCAACGAGTTATTGTCGCCAAGA
ATTTTATCTAATTTAAATACTACTAACACAAACATTTAATAAAATGTTTAAAATAGTCTG
ACTATTTCTACCTCTGCAGTCAGCAATCAGACAACAATAACAAGCGGGTTTAATTTTAAC
GCATCTGCATCATAAACAAACATTAATATTGAAGATAAAAAGAACTTCTCTAAAAATATA
AAAGACATTGTTGATTTGAATGAAAACAATTGTTTCTAAAAGTTATCTTATGATGACTGG
GAAATTCTTTTTGAAAGTGATGAAGAAAAGTACAGGTGTGGCGAATTTAAAAGAATATTT
CCTTCAAGTGATCTTAATTTGGTTGATTACTATAGCTAATTTTTTTTATTCCCTAGATAT
AATAATATTATGCTTTGGAATTATCTCAAATGCAGTATCAACATGCTGGAATATGTATGT
CCAAAATCTACTACTATAAAGTGTTGA


>TTHERM_00859290(protein)
MNSNLTITNGQICSPNLTGNELIFIKRPIIIKKPTNTNNNYNNIQCQTNTNANNAIQNRS
MINTSNIEQNYGQSAQDNLLTPQQKQANQFLTDQNKSKHAKYPRESSLHSSGQQRKSFVM
VTEKISGVENKEMLNGESQLQYSQVYNVQAHKNIQKQIISQRYLINNVTLSNNVLDANLL
IKRPPSASLNQKNKHQITVFQQQQLSFLSSQQQNLSNGLNKKLTINNIQSASGHQSQNQK
GNQISYKQKQKITNDNFRKDKNENNFNKKEDIPSYFMDNYNDVRQVVFYKDNNPSYTQRL
LKEKNEQQIVVSSKTQDAYQSSRNQNKYLSNSTLRKKDPNLLRESDEFQMQKNFQVNYQS
IEKPSILNKTQLTNSYFIDSSVIKSPLMSSQKSKQNLTTSSKQIKTYQLDKLMTNTNHKN
QFQQNSLSPYLQPNNIVKNYETNQKNSNSNSPKNSNRLRYLDDSNVHDERDDQSLQLQNS
YIEIFSSDLSKFKQIATKLEQSQHPINEQEHQEKSRNSSDSLDSSRKNQQRKHALAVSNM
QMNNEQKKNQSAQNQKQKQSKQNKIHEFQKEAKIVIQEPPNKVLSQNQEHRISQLRHKLL
EANEKALARKILVKKRSIAKQKSTNLCSVDDKNCSDQEENQQKLECEQPKKTTKSINKQN
RITKKGSLKKQDSNIISSTSQVELSHVKSLKVDNEIEAPQQKRKFSENRGTSQKRPPLPL
STNTKKQKEGFEEEDDDFPSLSNLSEIENQYDNLEFEDQEEDENQNDQDQNQEKTISNSM
HSSNKDQVGSATELAAKKQIIINKPLPVVTLLKSVYEGRPSTIFFEYPDCCFKKREQGNR
TYIANPKEVKKWNLTYRMNDCNRPYQCVTKSFEAGGFVETLSNTQWNGYWASNRISFIKK
LNSFQKTNHFAGCWNLGRKDQLWMRVSKQKRKFNEDYDFIPRTMLLGQEWDRFNTLLEDN
PETLWIVKPVASCCGKGVHVVQKKCNIAKRKRKHYLASEYISNPHLINDTKYDLRIYVLV
TSYDPLRIYMFEDGLVRFATEKYNLTQNGHQRQRFMHLTNYSVNKKSENFVKNNDVNDSG
QGSKWSLKSWKEYLIQTIGLEAKEQLLKKMEDVIIKTCIAVEPYMNDSSSKTAQHRNNCF
ELYGFDILIDNTLKPWLLEVNVCPSLSSSSPLDRKIKTSLISDIFNTLGFIPYDKKKLSQ
EKKFSNRNQKKKKTRYSVNMNKVIKEEQEQDNVNELLSPRILSNLNTTNTNIQQNVQNSL
TISTSAVSNQTTITSGFNFNASASQTNINIEDKKNFSKNIKDIVDLNENNCFQKLSYDDW
EILFESDEEKYRCGEFKRIFPSSDLNLVDYYSQFFLFPRYNNIMLWNYLKCSINMLEYVC
PKSTTIKC


>TTHERM_00859290(gene)
ATGAATTCAAATCTTACAATTACTAATGGGTAAATTTGCTCCCCTAATCTCACAGGCAAC
GAACTTATATTCATTAAAAGACCAATAATTATCAAAAAGCCTACCAATACCAATAATAAT
TATAACAATATTTAATGTTAAACTAACACTAATGCTAATAATGCTATTCAAAATAGGAGC
ATGATAAACACTTCAAATATTGAACAAAACTATGGATAATCTGCACAAGATAATTTACTA
ACACCTTAATAAAAACAAGCAAATTAATTTTTAACTGATTAAAATAAATCGAAGCACGCT
AAATACCCAAGAGAGTCTAGTCTTCATTCTTCAGGCTAATAGCGAAAGTCATTTGTTATG
GTAACTGAAAAAATTTCAGTAAATTAATACAAATTTTCATAGATAGTTTTTATTCAATTT
TGAAATAAATAATTAACAGGGAGTAGAAAATAAAGAAATGCTGAATGGAGAATCTCAACT
GTAATATTCTCAGGTCTATAATGTTCAAGCTCATAAAAATATTTAGAAATAGATCATTTC
TCAAAGATATTTAATTAATAATGTTACGCTCAGCAATAATGTTTTGGACGCTAATTTATT
AATCAAGCGACCTCCTTCTGCGAGTTTAAATTAAAAAAATAAACACTAAATTACTGTGTT
TTAATAGCAGCAGCTATCGTTTTTAAGCAGCTAACAGTAGAATTTATCTAATGGACTTAA
TAAAAAACTAACTATAAACAATATTTAATCAGCATCAGGGCATTAAAGTTAGAATTAAAA
GGGGAATTAAATATCATACAAGTAAAAATAAAAAATTAGTAATTTCTTATTAATACTGTT
GTTTCTTTTTAATAAAAAAATATTTACAGATTTAACAAATTTTTAACACTAAAATTATGT
TTTTACAAAAAAGCTAACGACAACTTTAGAAAAGATAAAAATGAAAATAATTTTAACAAA
AAAGAAGATATCCCATCATATTTTATGGATAACTATAATGATGTTAGGCAAGTAGTGTTT
TACAAAGACAACAACCCAAGCTACACTTAGAGGCTATTGAAAGAAAAGAACGAATAACAG
ATAGTAGTAAGTTCAAAAACACAAGATGCATATTAGAGTTCAAGAAATTAAAATAAATAT
CTCAGCAATTCGACTCTTAGAAAAAAAGACCCTAACCTTCTTAGGGAATCTGATGAATTC
TAAATGTAAAAAAATTTCCAAGTAAATTATTAGTCAATTGAAAAACCTTCGATTCTGAAC
AAAACGCAATTAACAAATTCTTATTTCATTGATTCATCAGTTATTAAATCACCTTTAATG
AGTTCATAGAAGAGTAAACAAAACTTAACTACCAGTTCAAAACAAATTAAAACATATTAA
CTTGACAAGCTAATGACTAATACAAATCATAAAAACTAATTCTAACAAAATAGCTTATCT
CCTTATCTCTAACCTAATAATATTGTCAAGAATTACGAGACTAACCAAAAGAATTCTAAT
TCAAATTCTCCTAAAAATTCTAACCGTCTGAGGTATTTAGATGATTCTAATGTCCATGAT
GAAAGAGACGATTAGAGTTTGTAATTATAAAATTCCTACATAGAAATATTCTCCAGTGAT
CTTTCCAAATTTAAACAAATTGCTACTAAATTAGAACAGTCTTAGCACCCAATAAACGAA
TAAGAGCACTAAGAAAAATCAAGAAATTCATCAGATTCTCTTGATTCTTCAAGAAAAAAT
CAATAGAGAAAGCATGCTTTAGCGGTAAGCAACATGCAAATGAATAATGAATAGAAAAAA
AATTAATCAGCTTAAAATTAGAAGTAAAAATAATCTAAACAAAATAAAATTCATGAATTT
TAAAAAGAAGCTAAAATTGTAATATAAGAACCACCTAATAAAGTTTTAAGTTAAAATTAA
GAGCACAGAATCTCACAGTTAAGACATAAGCTGCTTGAAGCTAATGAAAAAGCATTGGCT
AGAAAAATATTAGTAAAAAAAAGGTCAATTGCCAAACAAAAATCGACAAATCTATGCTCA
GTAGATGACAAAAACTGCTCTGATTAAGAAGAGAATTAGCAAAAACTTGAATGTGAATAA
CCTAAAAAAACTACAAAAAGTATAAATAAATAAAATAGAATCACTAAAAAAGGTTCTTTA
AAGAAATAAGACTCAAATATTATCAGCAGCACATCTTAAGTAGAGTTATCTCATGTAAAA
TCTTTAAAAGTAGACAATGAAATTGAAGCTCCTCAGCAAAAGAGGAAATTTTCTGAAAAT
AGAGGAACCTCGTAAAAAAGACCCCCACTACCTCTATCAACAAATACAAAAAAACAAAAA
GAAGGATTTGAAGAAGAAGATGACGATTTTCCCTCTTTATCAAATCTCTCTGAAATAGAA
AATTAATACGACAATTTAGAATTTGAAGATTAAGAAGAAGATGAAAACCAAAACGACTAA
GATTAAAATCAAGAAAAGACCATTTCAAATTCAATGCATTCTTCAAATAAAGATTAGGTT
GGTTCTGCTACTGAATTAGCAGCTAAAAAACAAATTATAATAAACAAACCTTTGCCTGTT
GTCACCTTATTAAAATCAGTTTACGAAGGAAGGTATTATTTAATTTACATGAATTTATCA
AATTTCAAAACAATATTTTTTTATAGACCAAGCACTATTTTTTTCGAATATCCTGATTGC
TGCTTTAAGAAAAGAGAATAAGGTAATCGTACGTATATTGCAAATCCGAAAGAAGTAAAG
AAATGGAATTTGACATATAGAATGAATGACTGTAATCGTCCATACTAATGTGTAACAAAG
AGTTTTGAAGCAGGAGGATTTGTAGAAACATTATCAAATACATAATGGAATGGGTATTGG
GCAAGCAACAGAATCAGCTTCATTAAAAAACTAAATAGCTTTTAGAAAACGAATCACTTT
GCAGGATGCTGGAATTTAGGAAGAAAAGATTAGCTTTGGATGAGAGTTTCAAAATAAAAG
AGAAAATTCAATGAGGACTATGATTTTATACCAAGGACTATGCTGCTTGGTTAGGAGTGG
GATAGATTTAACACGCTTTTAGAAGATAATCCTGAAACTCTATGGATAGTCAAGCCAGTA
GCTTCTTGTTGTGGCAAAGGAGTGCATGTTGTTCAAAAAAAATGCAATATTGCCAAGAGA
AAACGTAAACACTATTTAGCTAGTGAATATATTTCAAATCCTCATTTGATAAATGATACT
AAATATGATTTAAGAATATATGTCTTGGTGACTTCTTATGATCCGCTTCGTATTTATATG
TTTGAAGATGGTTTAGTGAGATTTGCCACAGAAAAATATAATTTAACTTAGAATGGACAT
TAAAGATAAAGATTTATGCATTTAACTAATTATAGTGTGAATAAAAAGAGCGAAAATTTT
GTTAAAAATAATGATGTGAACGACTCTGGTTAGGGTTCTAAATGGTCTCTAAAATCTTGG
AAGGAATATCTTATTTAAACAATAGGATTAGAAGCTAAAGAGTAGTTGCTAAAAAAAATG
GAAGATGTAATAATTAAAACATGTATCGCAGTAGAACCTTATATGAATGATAGTTCGAGC
AAGACAGCTTAACACAGAAATAATTGCTTCGAATTATATGGTTTTGACATTTTAATAGAC
AATACTCTAAAGCCTTGGCTTTTGGAAGTTAATGTATGTCCATCACTTAGTAGTTCCTCA
CCATTAGATAGAAAAATTAAGACAAGTCTTATAAGCGATATTTTCAATACATTAGGCTTT
ATACCTTATGATAAAAAGAAGCTCTCTCAGGAAAAAAAATTTAGCAACAGAAATTAAAAA
AAAAAGAAAACGAGATATTCTGTAAATATGAATAAAGTAATAAAAGAAGAATAAGAATAG
GATAATGTCAACGAGTTATTGTCGCCAAGAATTTTATCTAATTTAAATACTACTAACACA
AACATTTAATAAAATGTTTAAAATAGTCTGACTATTTCTACCTCTGCAGTCAGCAATCAG
ACAACAATAACAAGCGGGTTTAATTTTAACGCATCTGCATCATAAACAAACATTAATATT
GAAGATAAAAAGAACTTCTCTAAAAATATAAAAGACATTGTTGATTTGAATGAAAACAAT
TGTTTCTAAAAGTTATCTTATGATGACTGGGAAATTCTTTTTGAAAGTGATGAAGAAAAG
TACAGGTGTGGCGAATTTAAAAGAATATTTCCTTCAAGTGATCTTAATTTGGTTGATTAC
TATAGCTAATTTTTTTTATTCCCTAGATATAATAATATTATGCTTTGGAATTATCTCAAA
TGCAGTATCAACATGCTGGAATATGTATGTCCAAAATCTACTACTATAAAGTGTTGA