Identifiers and Description

Gene Model Identifier

TTHERM_00705080

Standard Name

TTL14 (Tubulin-Tyrosine Ligase)

Aliases

PreTt26863 | 111.m00084 | 3744.m00005

Description

Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00705080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17712.19.997093137033517e-262tubulin-tyrosine ligase (686 a
a)
OxytrichaContig16784.0.g331.9995541014149208e-99Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_234731.1089390193121365e-40
DictyBaseDDB_G02815412.0009605191578312e-25DDB_G0281541 on chromosome: 3
position 4627625 to 4629265
WormBaseWBGene000441871.0002869940498747e-21locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
SGDYBR094W9.995317835403734e-19PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00705080(coding)
ATGTCTGTGTCAACATATAATTCTCCCTAGAAGTAAAATTTAAGACATGATATGTCTCTT
CCGCAATAAAGTAATAAAGAGAAGCATTAGGAAGTTGTTTATAATGAAAGCAAAACTAAC
ATCAATTTCTACTAGAATTAGCTAGCAAATGGCTACATGTTTTAGCCTAATCGATATCAG
TCTTTCAAAAACATTAATAGTGACAAACAAAAAAAATAAACAAATCCTTTAAATGATTTG
CAATAGATAAAACTTTATAAAGAAAGTTAAATTTTTTATAAGAATGAATTAAATTAAGAT
AAAAGTAGTATTTATCCCTAACAAAATTTCCGTGTTAGGAGCAATCCTGTAAGCAAAGTC
GAATCAAGTTCTAAGTAGGATGCACGGGAAAATTAGATTAATAAAAACGACTTTCAATAA
ACAAATAATGCAGAATTTTCTATTTAACATCAAAATGTTGATACGAGTAAAAGTGCTATT
GAATCTCTAACTCCAAAATATTAATCAGATAGATATTTAAACAGAAAATCTCACGTAAAT
ACACCATAAAGTCCAAATACTAGTTAATTACAGATAATTTAAAATACTTCTTACAAAAAT
GGCATGAAATTTGTAAAGGAGAATAACCCACTGCAGTTTTTAACTATGGCTGAAAAAGAG
GACAATATCTAAAAATAGAAGAAATCTTCTATACAGTAAAAAATTTCTAACAAAAACCCC
AGAGCTATTCTCTATCCATTAATAAATACTTCTTCATTTATAAAACCTGAATATTAAAAT
GTTATTCGTTTAGAAAAAGACCAAATTAGTATTGCTTAAAATAATAATTTTACTCAACAA
TCTTCTTACAAATTTATTATCGGAAATGGCAACAATTCTTAGCTTGTTAGAGAAATTTTA
CAAAAAAAGGGAGGCTGGGAAGAAACTTAGTCCCATAATCTTTATTTTCATTTTAATTGG
TAACCTATAAGCTAAGGGATACATTTTGAAAGAATAAAAAGCACAAATTTGCATAGATAT
GTTGTAAACCATTTTGAGTAACATAAAGAAATATCATCGAAAATTAAATTAATTAAGAAT
TTAGAAAATCATTGTAGAATACAATAAATATATTTATTTGATATAACTCCAATTTCTTAT
TGTATTGATTATGAGCTTGATAATTATGAGCAGGAATTTGAGGATTTTTTAAGTTTTTTT
ATGAGTAAATCTCATAACCCTTCCATGGACTACATGTCAGTTGAACTTTTAAGAAGAAAA
AATTACTATAAAAACTCAACATACCCAGATAAGTAAATTATTGGGGCTTCTTTCAAGTCA
AGGCAAAGTGCTTATTAGGGATACTCATAACCTAGAAGTCACTTTACTATGTTTAAAGGA
CATAATATTTGGATGATTAAGCCTGCTGAGTTTAACAGAGGTAGAGGAATTAGAATATTT
ACATCTATCCAATAGCTAAATAAAATTCTTTCTGAATATTAGGAAGACAATGCGAAAGAA
ATCGCTCGCTATTAAAATTAAATTTAAGGTTTTAGCAGTCGCTACAATGCTTTTAGTTAA
GATAAAAAGAGGTCCAATTCAAGCTATAGCTCTACAAAAAGATATGGAAAACCAAAGATA
TCGCAGAGATACGTCATATAAAAATATATTGAAGCACCACTTCTAATTGATGAAAGAAAA
TTTGATATTAGAATGTGGGTTTTAATCTCTTTTGACAATAAATCCTATGTCTTTAAAGAG
GGATACATTAGAACAGCATGCGTAAGTTATGACACAAGCGAATAATCGTTAAGCAATAAT
ATAGTTCATTTAACAAATAATGCAATATAGAAGTATGCCAAAAACTATGGGGAACACGAG
CAAGGAAATTAGCTCTCATTTAAAAATTTTGAAGAATATTTAACTAAAAAACGGATTAAT
TGCAATTTTAATGCAAAAATATTGCCAAAAATAAAAGATGTAATGTCTCTAACAATAGAC
TCAGTTAAAAGCAAGTTAAACCCCTAGGAGAGAAAATTTTGTTTTGAAATTTTCGGTTAT
GACTTTATAATTGATAATAACTTCAATCCTTGGCTGATAGAAGTGAATACTAATCCCTGT
ATCGAATAATCAAGTGATATGCTTTCTATCCTACTAAAAAGAATGCTGGATGATGCATTT
AAATTAACACTTGATTAATTATTTAATCCCACTGCTAAGTAAGAAGAGTCATAATATCCT
GTAGAGGGTTATAGTAACAAAGAGAATATGTGGGAGTAGCTCATTTCAGGGACATACCAA
AATCTTCGCGGATGCCAAAGTTCTTTAATAAAAAAAAAATGA


>TTHERM_00705080(protein)
MSVSTYNSPQKQNLRHDMSLPQQSNKEKHQEVVYNESKTNINFYQNQLANGYMFQPNRYQ
SFKNINSDKQKKQTNPLNDLQQIKLYKESQIFYKNELNQDKSSIYPQQNFRVRSNPVSKV
ESSSKQDARENQINKNDFQQTNNAEFSIQHQNVDTSKSAIESLTPKYQSDRYLNRKSHVN
TPQSPNTSQLQIIQNTSYKNGMKFVKENNPLQFLTMAEKEDNIQKQKKSSIQQKISNKNP
RAILYPLINTSSFIKPEYQNVIRLEKDQISIAQNNNFTQQSSYKFIIGNGNNSQLVREIL
QKKGGWEETQSHNLYFHFNWQPISQGIHFERIKSTNLHRYVVNHFEQHKEISSKIKLIKN
LENHCRIQQIYLFDITPISYCIDYELDNYEQEFEDFLSFFMSKSHNPSMDYMSVELLRRK
NYYKNSTYPDKQIIGASFKSRQSAYQGYSQPRSHFTMFKGHNIWMIKPAEFNRGRGIRIF
TSIQQLNKILSEYQEDNAKEIARYQNQIQGFSSRYNAFSQDKKRSNSSYSSTKRYGKPKI
SQRYVIQKYIEAPLLIDERKFDIRMWVLISFDNKSYVFKEGYIRTACVSYDTSEQSLSNN
IVHLTNNAIQKYAKNYGEHEQGNQLSFKNFEEYLTKKRINCNFNAKILPKIKDVMSLTID
SVKSKLNPQERKFCFEIFGYDFIIDNNFNPWLIEVNTNPCIEQSSDMLSILLKRMLDDAF
KLTLDQLFNPTAKQEESQYPVEGYSNKENMWEQLISGTYQNLRGCQSSLIKKK


>TTHERM_00705080(gene)
TTCTATTAAACAATCAAAAATCAAATTATTTCAAATATAAGAAACTTTTAAGTATTGTAA
ACATCTAAAAGCAATTAGCAGAGATTACTTAGATTACTAACTTTAGCGAATTTCTTAGTT
TAATATAACTCTTAGCAATAAAAATAAATGTCTGTGTCAACATATAATTCTCCCTAGAAG
TAAAATTTAAGACATGATATGTCTCTTCCGCAATAAAGTAATAAAGAGAGTAAGTAATTG
TAGATTTTCTAAAAATTCTAAATAATTTATTTAAATTTTTTGAAAATATCATAATAGAGC
ATTAGGAAGTTGTTTATAATGAAAGCAAAACTAACATCAATTTCTACTAGAATTAGCTAG
CAAATGGCTACATGTTTTAGCCTAATCGATATCAGTAAATTTGATAAGTGTTATAAAATA
TGTTTTAATTATTATTTAAAATAATTAGGTCTTTCAAAAACATTAATAGTGACAAACAAA
AAAAATAAACAAATCCTTTAAATGATTTGCAATAGATAAAACTTTATAAAGAAAGTTAAA
TTTTTTATAAGAATGAATTAAATTAAGATAAAAGTAGTATTTATCCCTAACAAAATTTCC
GTGTTAGGAGCAATCCTGTAAGCAAAGTCGGTAAAAATCTTTAAAATGATAGATAGATGA
TTTAATTAAAATGTAAAATTAAAAAAATTAGAATCAAGTTCTAAGTAGGATGCACGGGAA
AATTAGATTAATAAAAACGACTTTCAATAAACAAATAATGCAGAATTTTCTATTTAACAT
CAAAATGTTGATACGAGTAAAAGTGCTATTGAATCTCTAACTCCAAAATATTAATGTAAA
TAACGAAACGTTATATTTAAACTGAATCATGATTTTTTTAAGAAGATTTTTAACAACTTT
ATAAAAATTTATTTAATATTTAAACATAAAATGTATTTGTTTATTTGTTTCTTTGGATAT
CAAACAAGAAAAACTAACACTCAATTACCAAAGTTTATTTAATTTCTTTTAATGAATGAA
AGCAGATAGATATTTAAACAGAAAATCTCACGTAAATACACCATAAAGTCCAAATACTAG
TTAATTACAGATAATTTAAAATACTTCTTACAAAAATGGCATGAAATTTGTAAAGGAGAA
TAACCCACTGCAGTTTTTAACTATGGCTGAAAAAGAGGACAATATCTAAAAATAGAAGAA
ATCTTCTATACAGTAAAAAATTTCTAACAAAAACCCCAGAGCTATTCTCTATCCATTAAT
AAATACTTCTTCATTTAGTAAAGCAATCATTAACTTGCTAACATTTATATTTATAATTAT
TATTTTTTATTAAAAGTAAAACCTGAATATTAAAATGTTATTCGTTTAGAAAAAGACCAA
ATTAGTATTGCTTAAAATAATAATTTTACTCAACAATCTTCTTACAAAGTAAATGCTCCA
TTTATCTTCATAGATTTTACAAATGCAATATCTTTTTTACACTTTTTGGATATTTTGAAG
TAAAAATAATAAAGATTCTAACAAAATTATTATTTTTTCATAAATAATTTTTATAAATTT
TGGTTGCTTAAAACACAAAAACTTTGAACTTGAAATAATTAATTTTATTTAATTTATTCT
TTTTTTAATGAAATTTAAAATAAAAATTATGATTCAAGAAAAAGTATTAAAAAAACTGCT
TTTCTTTATAATTAAGCAAAAGCTATTTAGAAATAATTTGAGCTTTTTATGTGAAATTTG
ATGAATTGAATAATTTTATGATTTAAATAGTTTTTATGAATACATTTTTTCAACTTAAAT
AGTTTATTATCGGAAATGGCAACAATTCTTAGCTTGTTAGAGAAATTTTACAAAAAAAGG
GAGGCTGGGAAGAAACTTAGTCCCATAATCTTTATTTTCATTTTAATTGGTAACCTATAA
GCTAAGGGATACATTTTGAAAGAATAAAAAGCACAAATTTGCATAGATATGTTGTAAACC
ATTTTGAGTAACATAAAGAAATATCATCGAAAATTAAATTAATTAAGAATTTAGAAAATC
ATTGTAGAATACAATAAATATATTTATTTGATATAACTCCAATTTCTTATTGTATTGATT
ATGAGCTTGATAATTATGAGCAGGAATTTGAGGATTTTTTAAGTTTTTTTATGAGTAAAT
CTCATAACCCTTCCATGGACTACATGTCAGTTGAACTTTTAAGAAGAAAAAATTACTATA
AAAACTCAACATACCCAGATAAGTAAATTATTGGGGCTTCTTTCAAGTCAAGGCAAAGTG
CTTATTAGGGATACTCATAACCTAGAAGTCACTTTACTATGTTTAAAGGACATAATATTT
GGATGATTAAGCCTGCTGAGTTTAACAGAGGTAGAGGAATTAGAATATTTACATCTATCC
AATAGCTAAATAAAATTCTTTCTGAATATTAGGAAGACAATGCGAAAGAAATCGCTCGCT
ATTAAAATTAAATTTAAGGTTTTAGCAGTCGCTACAATGCTTTTAGTTAAGATAAAAAGA
GGTCCAATTCAAGCTATAGCTCTACAAAAAGATATGGAAAACCAAAGATATCGCAGAGAT
ACGTCATATAAAAATATATTGAAGCACCACTTCTAATTGATGAAAGAAAATTTGATATTA
GAATGTGGGTTTTAATCTCTTTTGACAATAAATCCTATGTCTTTAAGTAAACTTATTACA
GAATAAATCTAATGAATAAATTAATAATTCATATTCCTTTCTTTTGGCTTAATAAACATG
CTCAAAATTTTTTTAAACAGTCATTAATTCGTTAGAAGTTCTAGACTAAAACCATTTAAA
GTCCAATAGTTTGTTTTAGAAACATTTCTTAATTTTTTTTATACAGTGGAAATTCTTTAA
AAAAATATATAAAACATATGTTCAATAATAAACTTAAAAAACCTGTTTCTTATTAATCAA
AAACTCAATAAAAGAAACATAAATAGAGATATATATATAGATAGATAGATAAATAGATGA
GTCTATTTTAAATTAAAAAGATTTTTAATACTTTTTAATAAATTTAATTTTTAAATTTGG
TTGATTCTTAATGAAAAAAAAAATATTGTAAAGTAGATAGAGTTGAGAAAAAACACCTCG
CTAAGATTTTTATAAAAAATAACTTTAAATATTCGAGAGGATTTTTTTAAAAGTGAAAAA
ATACAAATTTTTTATTAAAAATATTTAATTCCAAAGAGAGAGAGAGATTGGGTAGGGTTT
ATTGACCAAATAATATTTTTAAATTAAGCAAATTATGTAACATTATTAACAAAAACATTT
TCAAACAGGAGTTAAGTTAGATTCCGATTATTGATCATTTAATGAACTTTTAGATGTATT
TAAATCACTGTTAAGCATTAGAATTGATAGAAATTTAAAGAAAATCAACATTTTTTTTAC
AAAAAGCTTGAAAATAGTTATATTTACTTTTGTTCATTACATAAAAAATTTAAAAATAAA
TTTGAATTTAATTTAATTAGAGAGGGATACATTAGAACAGCATGCGTAAGTTATGACACA
AGCGAATAATCGTTAAGCAATAATATAGTTCATTTAACAAATAATGCAATATAGAAGTAT
GCCAAAAACTATGGGGAACACGAGCAAGGAAATTAGCTCTCATTTAAAAATTTTGAAGAA
TATTTAACTAAAAAACGGATTAATTGCAATTTTAATGCAAAAATATTGCCAAAAATAAAA
GATGTAATGTCTCTAACAATAGACTCAGTTAAAAGCAAGTTAAACCCCTAGGAGAGAAAA
TTTTGTTTTGAAATTTTCGGTTATGACTTTATAATTGATAATAACTTCAATCCTTGGCTG
ATAGAAGTGAATACTAATCCCTGTATCGAATAATCAAGTGATATGCTTTCTATCCTACTA
AAAAGAATGCTGGGTAATTAAATTAATAGTATATTTGCTTAATAGTTAATAATTATAATA
GAATTTAGTCTAAAAAAATCGAGCTAATAAATCATCCATCTTACATATCTAAAATACTTT
TCAACCATGTTATTTATAATAAATTGTTAATAAAGAATATTTTTAATTTGCCATAGAAAA
TGTTCGTTTAGAAAGACCTAACTATGATTAGGCAATTACAAATAGGTTATTATATTGTAA
TAAATACAAAATTAAATTTTTATTTATCATAAATTATTTTTATAAAATTTAATCTAGCTT
ACAAATCAACAAGAAACAAAAAAATATTAATTTACTATTTACTTTTTTATATAATTATAT
AATTATATAATTATTAAATTAGATGATGCATTTAAATTAACACTTGATTAATTATTTAAT
CCCACTGCTAAGTAAGAAGAGTCATAATATCCTGTAGAGGGTTATAGTAACAAAGAGAAT
ATGTGGTAAATACTTAAAGTATATTTTAACTAATTTATGTTGAGATATTCAATTTTAATG
ACAAAAGGGAGTAGCTCATTTCAGGGACATACCAAAATCTTCGCGGATGCCAAAGTTCTT
TAATAAAAAAAAAATGA