Identifiers and Description

Gene Model Identifier

TTHERM_00404280

Standard Name

TTL10 (Tubulin-Tyrosine Ligase)

Aliases

PreTt12774 | 43.m00292 | 3713.m00116

Description

Tubulin-tyrosine ligase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00404280

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13956.19.997093137033517e-262tubulin-tyrosine ligase (747 a
a)
OxytrichaContig14300.0.g1069.997093137033517e-262Tubulin-tyrosine ligase family
Stentor CoeruleusSteCoe_354888.985825944049381e-37
WormBaseWBGene000441873.0002687256732656e-20locus:ttll-9 status:Partiall
y_confirmed UniProt:Q564U4
protein_id:CAI79169.1
SGDYBR094W0.000000000003001226732525078PBY1 Putative tubulin tyrosine
ligase associated with P-bodi
es
DictyBaseDDB_G02789030.0004999512321494991DDB_G0278903 on chromosome: 3
position 1368428 to 1369840

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00404280(coding)
ATGGCTGATACCAATCTAGAAAAGGAAATTTTAAAGGTCGAATAAAATAACGATAACTAA
GAAGACCTAAACGATGCAAGTAAAAAGTCTCTCTAAGAATCTTTTTAGAAGTTTAGAAAA
GAAAGATATGAAAAAATGAAACATGCAAAATATTTAAAAGCTAAGAAATAAGATGAAAGG
AGAACTGCTGAATTTAAAGAGGCTTTAAGATAAAAGTTTATTGATTAGTGTAAAAAGTAC
TTTGGTGTTCCTTACCATAGAAAGTACTGGACTGAAGGAGAATCTCATCATAATGCTCCT
CTTTATTTAGATTGCTGTGGTTTGATAAGATAGGTTGTTTATGATCTCAGAGAAGACTTT
GGATTTACTCTTGGTAGATGGAATCAGGCTTATCAGTTTGATGTTTGCCCAAAAGAAGTA
AAATTTGAAGAAATGAAGCCTGGTGATTTAATTTTTTATTCTGGAACTTACTATAACGAA
AAACTTAAACCTTTCCCTCATAAGATGGTGCATGTAGAAGTGTTTACTGGAGGAGAGACA
GGTGAACAAACAATAGGAGCAAGATGGCAGAAGGGCTTTGTTTAATATCATGATAGCTAT
AAGTTTGTCAGCAAAAATTACTATGATATTTAATTTTATTATAGATCGTTAGATCCTTGG
CTTGATGGTATTTGCTAATCCTGTTGTAAGGAACATCCTTGGAGAGATGATAGAGATCTT
TGGGTTCCAGATAAATTTTCAGTATTTTCAGATCCTACATTAGAAGAAAACGAAGATGCA
GATTAAAAAGAAGAAATAGATGAAAATTAAGAGGATAAAGAAAATAGACAAGTACAACAG
GCTGCTAACTAATTGGCAAAATTCTCTTTAAAATAAAGTATTAAAACTAAAAAAGATGAG
TCTAAATATGTGTTTGTTGGAAAGGGTAATAATGATAATCTAATAAGAAAATACTTTTCA
AATATTCCTGGCTACACTTTACTAGATGCTTCTAAGGCTTTTTCAAATAAATATTTTTTT
AAGTGGGTTTAGACAACTTCTGAAATTGACTTTTTTTCTTTTAAAGAAGCAACCTAAATT
GTAAACCACATTCCAAATATTAACATTTTTACCAGCAAAGTTGGTTTAGTTAATTTGCTG
AAATCTTATGAAGAACATAAAAATATTGCTGATCTTGAAATAAGCTCTAAAGATTTTTTC
CCAGAGAGCTACTAACTAGATATGATGAGTGATGAAATAGCTTTCCTAACTTAAGAAACA
GATCCAAATAGCATTTGGATATTAAAACCACATAACAACAATATGGGAAGAGGAATAATA
ATGATTGGAGATATAGTAACTTTCAAGAGAGAATTCGTAGAAACAAAGAAATATAAATTA
GGAGAATATACAACAGCCTACTTGATTAAAAAAGACAATTCGATTGAAGATAATTAAATT
GAATAATTATAAAAAAATAGTATATAAAATGATAGCAAAGACCAATAAAGTAGTTCATTA
GATAATTAAGAAACAAATAAAGTTTAAGAATAACCTAAATTTAAATATGATGGTATTTCA
CATCACTCTATTATTTAAAAGTATATTAAAGAACCACTCCTTCTTAATAAGCGTAAATTT
GATATAAGGTGTTATGGACTGATTGCTAGTACAAAACCCCTTTTGCTTCTATTCAACAAA
GGATATGCTAGAGTATGTTTGCAGGAATACTCTTTAGAAGATGTAGAGAGCAAAAATAAT
AAATATTGCCACCTTACAAATAATGCAATTCAAAAATCTCATAAAGATTTTAAAGCACAT
AAAGAAGACTCTATATGGACTATTGAGAAACTTTCAGAATATGTTGAAAAGGTTTATTAA
TTTGGATAAGAAAAGCAAAATGAGATGTGGAATCAAATAAAAAAAATAATTAGACATGTT
GTTTTAGCAGGTTATCCAAAATTAGAAAAGAAAGTAGGTTAATACGAATTACTTGGTGTT
GATATACTGATTGACTAGAATTTGAAACCTTATTTACTTGAAGTTAACACAAATCCAGCA
CTTTTTGTGGATACTACTAGCTAAGAGAAAGTAATACCACAAATGATGCACAAAGCATTA
GACATTGTTTTGGCAGTAAATGAAGGATTTGAAAATATCAAATAAAATATTGAAGAATTA
ACAAATAAATAAGAAATACATCCTTTCGAAATAATATATTAATAGAGTTAAGAGTGA


>TTHERM_00404280(protein)
MADTNLEKEILKVEQNNDNQEDLNDASKKSLQESFQKFRKERYEKMKHAKYLKAKKQDER
RTAEFKEALRQKFIDQCKKYFGVPYHRKYWTEGESHHNAPLYLDCCGLIRQVVYDLREDF
GFTLGRWNQAYQFDVCPKEVKFEEMKPGDLIFYSGTYYNEKLKPFPHKMVHVEVFTGGET
GEQTIGARWQKGFVQYHDSYKFVSKNYYDIQFYYRSLDPWLDGICQSCCKEHPWRDDRDL
WVPDKFSVFSDPTLEENEDADQKEEIDENQEDKENRQVQQAANQLAKFSLKQSIKTKKDE
SKYVFVGKGNNDNLIRKYFSNIPGYTLLDASKAFSNKYFFKWVQTTSEIDFFSFKEATQI
VNHIPNINIFTSKVGLVNLLKSYEEHKNIADLEISSKDFFPESYQLDMMSDEIAFLTQET
DPNSIWILKPHNNNMGRGIIMIGDIVTFKREFVETKKYKLGEYTTAYLIKKDNSIEDNQI
EQLQKNSIQNDSKDQQSSSLDNQETNKVQEQPKFKYDGISHHSIIQKYIKEPLLLNKRKF
DIRCYGLIASTKPLLLLFNKGYARVCLQEYSLEDVESKNNKYCHLTNNAIQKSHKDFKAH
KEDSIWTIEKLSEYVEKVYQFGQEKQNEMWNQIKKIIRHVVLAGYPKLEKKVGQYELLGV
DILIDQNLKPYLLEVNTNPALFVDTTSQEKVIPQMMHKALDIVLAVNEGFENIKQNIEEL
TNKQEIHPFEIIYQQSQE


>TTHERM_00404280(gene)
ATGGCTGATACCAATCTAGAAAAGGAAATTTTAAAGGTCGAATAAAATAACGATAACTAA
GAAGACCTAAACGATGCAAGTAAAAAGTCTCTCTAAGAATCTTTTTAGAAGTTTAGAAAA
GAAAGATATGAAAAAATGAAACATGCAAAATATTTAAAAGCTAAGAAATAAGATGAAAGG
AGAACTGCTGAATTTAAAGAGGCTTTAAGATAAAAGTTTATTGATTAGTGTAAAAAGTAC
TTTGGTGTTCCTTACCATAGAAAGTAATTGAATAAAAAATAAATTATATAAACACTAAAA
TCATATTTTCAATTCAATAATTAGGTACTGGACTGAAGGAGAATCTCATCATAATGCTCC
TCTTTATTTAGATTGCTGTGGTTTGATAAGATAGGTTGTTTATGATCTCAGAGAAGACTT
TGGATTTACTCTTGGTAGATGGAATCAGGTATTAATAATAATAATCAAAGATATAATTGA
GATAAAAAAAATTTATTCATTTTTCACTTGTTTCTTGTTTAATAATTCATATTTTTTTTT
AGGCTTATCAGTTTGATGTTTGCCCAAAAGAAGTAAAATTTGAAGAAATGAAGCCTGGTG
ATTTAATTTTTTATTCTGGAACTTACTATAACGAAAAAGTAAATAAATATCAATCTAAGT
GATCAGTCAATTAATATAATAAATTTTGGAAAAATATAAAAAGCTTAAACCTTTCCCTCA
TAAGATGGTGCATGTAGAAGTGTTTACTGGAGGAGAGACAGGTGAACAAACAATAGGTAA
ATTTAAGTTGCATTCAATTTATATTTATAAGCTTTTTTGTGAATAAAAGCTCAAGTTTTG
AGTGAATTTTAAAATAATTCTTTTAATTTATTTTATTAAAGAAGTTTAAATTTTTTCAAT
CATATTTTTAAATTTGAATTTTTAGCTGAACAATTTCCTAATTTAATTAATAATATATAG
GAGCAAGATGGCAGAAGGGCTTTGTTTAATATCATGATAGCTATAAGTTTGTCAGCAAAA
ATTACTATGATATTTAATTTTATTATAGATCGTTAGATCCTTGGCTTGATGGTATTTGCT
AGTAATAAAAATAATTTATTTATCCTACAGAATCTCAATACTTTTTTAATTAAATTAGAT
CCTGTTGTAAGGAACATCCTTGGAGAGATGATAGAGATCTTTGGGTTCCAGATAAATTTT
CAGTATTTTCAGATCCTACATTAGAAGAAAACGAAGATGCAGATTAAAAAGAAGAAATAG
ATGAAAATTAAGAGGATAAAGAAAATAGACAAGTACAACAGGCTGCTAACTAATTGGCAA
AATTCTCTTTAAAATAAAGTATTAAAACTAAAAAAGATGAGTCTAAATATGTGTTTGTTG
GAAAGGGTAATAATGATAATCTAATAAGAAAATACTTTTCAAATATTCCTGGCTACACTT
TACTAGATGCTTCTAAGGCTTTTTCAAATAAATATTTTTTTAAGTGGGTTTAGACAACTT
CTGAAATTGACTTTTTTTCTTTTAAAGAAGCAACCTAAGTAAAAATTATTTAAAATAATT
TTCTAACTGAATTTTAATATTAATATTGTATAGATTGTAAACCACATTCCAAATATTAAC
ATTTTTACCAGCAAAGTTGGTTTAGTTAATTTGCTGAAATCTTATGAAGAACATAAAAAT
ATTGCTGATCTTGAAATAAGCTCTAAAGATTTTTTCCCAGAGAGCTACTAACTAGATATG
ATGAGTGATGAAATAGCTTTCCTAACTTAAGAAACAGATCCAAATAGCATTTGGATATTA
AAACCACATAACAACAATATGGGAAGAGGAATAATAATGATTGGAGATATAGTAACTTTC
AAGAGAGAATTCGTAGAAACAAAGAAATATAAATTAGGAGAATATACAACAGCCTACTTG
ATTAAAAAAGACAATTCGATTGAAGATAATTAAATTGAATAATTATAAAAAAATAGTATA
TAAAATGATAGCAAAGACCAATAAAGTAGTTCATTAGATAATTAAGAAACAAATAAAGTT
TAAGAATAACCTAAATTTAAATATGATGGTATTTCACATCACTCTATTATTTAAAAGTAT
ATTAAAGAACCACTCCTTCTTAATAAGCGTAAATTTGATATAAGGTGTTATGGACTGATT
GCTAGTACAAAACCCCTTTTGCTTCTATTCAACAAAGGATATGCTAGAGTATGTTTGCAG
GAATACTCTTTAGAAGATGTAGAGAGCAAAAATAATAAATATTGCCACCTTACAAATAAT
GCAATTCAAAAATCTCATAAAGATTTTAAAGCACATAAAGAAGACTCTATATGGACTATT
GAGAAACTTTCAGTAATTTTTGTTATTTGCTTTAATTTGATATTATAATGGATAATCAAT
CTAAAATAGATTTTGATAATAATTAATTAATATTTGTTTTATATATAGGAATATGTTGAA
AAGGTTTATTAATTTGGATAAGAAAAGCAAAATGAGATGTGGAATCAAATAAAAAAAATA
ATTAGACATGTTGTTTTAGCAGGTTATCCAAAATTAGAAAAGAAAGTAGGTTAATACGAA
TTACTTGGTGTTGATATACTGATTGACTAGAATTTGAAACCTTATTTACTTGAAGTTAAC
ACAAATCCAGCACTTTTTGTGGATACTACTAGCTAAGAGAAAGTAATACCACAAATGATG
CACAAAGTAATAAAAATATAACTTACTTTCTTCAAAAAAAAAAAAATTTAATAAAATAAT
TTGTGGCAGTTTGAATAATTAATTTAGATAAATTATAAAATTTATAACTTTTGATTAATA
ATAAAAAAAATAGGCATTAGACATTGTTTTGGCAGTAAATGAAGGATTTGAAAATATCAA
ATAAAATATTGAAGAATTAACAAATAAATAAGAAATACATCCTTTCGAAATAATATATTA
ATAGAGTTAAGAGTGA