Identifiers and Description

Gene Model Identifier

TTHERM_01321540

Standard Name

None

Aliases

PreTt23970 | 324.m00016

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF02524 ) KID repeat
  • ( PF03789 ) ELK domain
  • ( PF01576 ) Myosin tail
  • ( PF07337 ) DC-EC Repeat
  • ( PF09311 ) Rab5 binding
  • ( PF02151 ) UvrB/uvrC motif
  • ( PF02370 ) M protein repeat
  • ( PF01920 ) Prefoldin subunit
  • ( PF00831 ) ribosomal protein L29
  • ( TIGR00012 ) ribosomal protein L29
  • ( PF00170 ) bZIP transcription factor
  • ( PF04702 ) Vicilin N terminal region
  • ( PF07926 ) TPR/MLP1/MLP2-like protein
  • ( PF00038 ) Intermediate filament protein
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF04849 ) HAP1 N-terminal conserved region
  • ( PF03938 ) Outer membrane protein (OmpH-like)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF05911 ) Plant protein of unknown function
  • ( TIGR01837 ) poly(hydroxyalkanoate) granule-associated protein
  • ( PF04871 ) Uso1 / p115 like vesicle

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_01321540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20069.19.997093137033517e-262hypothetical protein (1039 aa)
OxytrichaContig11784.0.g112.0008734984431652e-95Reovirus sigma C capsid protei
n
Stentor CoeruleusSteCoe_172782.6786369618080778e-33
SGDYDR356W0.0000009995106777214876SPC110 Inner plaque spindle po
le body (SPB) component, ortho
log of human kendrin; involved
in connecting nuclear microtu
bules to SPB; interacts with T
ub4p-complex and calmodulin; p
hosphorylated by Mps1p in cell
cycle-dependent manner

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01321540(coding)
ATGGCGGAGAACTTGTCTGACTTGCACCACAAAATGTGCAAAAAAGTAGCATAATTAACC
AAGGTTATATTCTTTTTGAATACGAAGAACGATGAGTATGAGTAGAATCTCAAAGCAGTA
GTTTAAGCTTACGAGCAATAATTAGACTAAACAGTAAAAGAAGGCAATTAGATTATTACC
AAATACAAAGAGGCTCTAGACAAGGCTTCTAAGAACGAAGATTTAGCTAATTAGGTGATG
AAGATGAAACAGCAAATAGATCAAGAGAAGCAATAAAGTCAACAAGAGTTTACCAAATAC
AAACAGAAATGCGAAGAAAAAGAAGGTTAGTTAATTAGGGAATGTGCAAAGAAAATTGAC
ACTTACAAACAAGAATGCGAAGGGTTCAAAGTTAAAATTGAATAATTAACTACAAACCTC
GATAAGGTGATCAACAACTCAGAGTCGAATAAAAAAAACCACCAAAAGGAACTTGCAGAT
TATGTCAAAGAACAAAATGAAAAATACAACGACTTACTCAAAAAAAAGTTAGATTTAGAA
GATCAGTTAGAAAAACGCGACGCCGAAATCGCCCAACTTAAAAAAAAAATTGATGAATTA
AACAAAAAAATCATGGACGACTTGAAGAATCAAAAGGGATAATCCTAACAAATGCTTGAA
GAACTTAAAAAAAATTATGAGAACAAAATTGCTGATTTAGAAGGAAAGAATAAAGAATTA
CTTTAAAAAATACAATCTCTTGAAGCTGAAATCTAATCGCTTCGTATGTAGTTAAATAAT
AGGGAAACTGAATTAAAGACTGTTTCAGATGAGAGAAACTAACTCAAGAAAATGACTGAG
AGATAAGCTCTGCAAATTTAAGAATAACAAAAAGAAATTGATGGGTTGAAGGTCGAAAAA
CAACAAAATTTTGAAAAAATCAAGCAGTTAGAAGCTGCAAATCAAGCACTTGAAAAGAAA
ATTAAAGACTATTAAGATTAGTTAGATAAATATGGTAAGGATAATAACATGAAAGACTCT
GAAATCGGAACTTTAAGAAAGTAGTTTGAGAAGACTTTGTTTGATAAAAATGAAGAAATT
AAAGGCGTACGCGCTTAATTGATGGAACTTTAAAAGCAATATGATTTATTATAAATTCAA
TTAAAAACTACTTAAGCCGAAAGAGAAGCTGAAAATAGAGAAAAGGATGCATAAATTGCT
GATCTGTTGAAGCAAGTTAAAGCTCTTCAAGAAGAAATAGCTAGTCTTTCTAACAACTCT
GAAGGACAACTCAAATAACTTCAAGAAAAACTTAAACAAAAAACACTTGAGTTTGAAGAT
TCTAAAAGAACTCTTATTGAAGATTACTCTAATCAACTCTCTGCTTAAGAAAAGAAATAC
TTGTAACAAATAGAAGACTTAAAGAGAGACTATGAGCAAAAGATACGTTAGTTGACTTAA
GAAAATTCCTAAAAAGAAGCAAGCTTAATATAAAAGTACGAAGAATAATTAAAAAAACTC
AGAGATGAGATGGATGAATAAAAGAGATAATACGAGAACAATGCCGGTTCTATGGAAAAG
AAGCTACAATAAACTATTGAAAAACAACAAGAATAAATTAATGGCTTGAACAAATAAATT
ACTGAGCTTTAAACAAGAATCTAAAACTTAGAGAATACAATTAACTAGAAAGACTTGGAT
ATAAATCAAAGAGACTCAATGATTTAATCTCTGAAGTAAACTATATCAGATCTTGAGATT
AAATTTTAATAGCAAAATGCAGATGGTTCTTCAAGATAAAGGGAACTTGAAATTGAAATT
TAGAATCTCAAAAAGTCTCTTGAAGACCAAGAAAGAAAATACAGAGATGAGATAGAAAGA
CTAAAAAATAATGCTAATGGTGAGCTTTCTGATACTATTGCTCGTATGAGAATCCAATAT
GAGGGAGAAATGAATGCTATGAGATCTTAACATTAGTCAGAAATTACAAGATTAGAAAGA
CAAAAAAATGAAGAAATAAAAAATTTGAGGGATTAGCTTAATTTGCTTAAAGAATAAATG
CAAAATGATAGCTCTGACTTGCTTTCTAAACTTAAACAGAGAGAACAAGAATACGAAGAT
TAAATAAAACAAATAAACCAAAGACACAACTATGAACTTAAGTTGATTGAAGAAAAGAAC
TAGCAAATGCTAAATCAAACTAAGACTTATTATGAAGACGAGCTGAAGAAATTGAGAGAA
TAACTTGAGTTTGAAAAAACCAAAGCTCTTTAGAAATTACAAGATGAGAAGGAAGCTGAA
ATTGCTAAACTTAAATAAACTCACGAAGATAAATTGACTTCACTTTCCAAGAATTTCGAT
AAATAACTTGCTGAACGTCAACAAGAATTTGAAACTAAGATGAAACTTCTTTAGAAGAAA
GTTGAGGATGAGGAAAAAGCTCATTTCTCTACTAAGGAAGAACTCAAAACAACTTAAACT
AATCTTACTGATCAAATTAGCTAAAACAAAGACTTAAAACAAAAAACAGACAAATAAATT
TTTGATATGTCTGCTGAAATCAAGGCATTAAAGCAATAAATGGAAGAACTCATCTAATAA
TAGACAGAGGCTTTACTTGCCAGAGATCAATAAGTCGAAGGTATCAAGAGAGATTATCAA
AGAAAAGAAGAAGAAGTATTGAGAAAAGCTAACGAGTTGGTGAATAGAAAAATAGCCGAA
CAACTAGAATTCATTGAGCAAATGAAGATTGAATTCAACTAGGTAGAATCTGCTTTGACA
GAGAAATATGTTCGCTTAGAAAATGACTATAATGATCTCCAATAAATGTTTGAAGATAGA
CCTTCAAGACCAGAAGATATCGAAACAATTAAGTTGTTGCAAGCTGAAATCATGAGAAAG
GAACAAGAAATAGGAAAACTTAATGAACAAATGAAATTCTTCAAGCTAGAATTAATTAAC
AGAGAAAACAACTATAATAAGATGTTCAACGCTAATCCTAATGTAGGTGTTATGAACCCT
TTAGATTAAAAAGGATAAACAGCTATGAGAGTACTACCTTAAAGCAACAAGCTAATAAGC
TAAACATCTGGACTGATTAGCGGAGGACAAAAAAGACCTAGCAAGAATAACGTTTGA


>TTHERM_01321540(protein)
MAENLSDLHHKMCKKVAQLTKVIFFLNTKNDEYEQNLKAVVQAYEQQLDQTVKEGNQIIT
KYKEALDKASKNEDLANQVMKMKQQIDQEKQQSQQEFTKYKQKCEEKEGQLIRECAKKID
TYKQECEGFKVKIEQLTTNLDKVINNSESNKKNHQKELADYVKEQNEKYNDLLKKKLDLE
DQLEKRDAEIAQLKKKIDELNKKIMDDLKNQKGQSQQMLEELKKNYENKIADLEGKNKEL
LQKIQSLEAEIQSLRMQLNNRETELKTVSDERNQLKKMTERQALQIQEQQKEIDGLKVEK
QQNFEKIKQLEAANQALEKKIKDYQDQLDKYGKDNNMKDSEIGTLRKQFEKTLFDKNEEI
KGVRAQLMELQKQYDLLQIQLKTTQAEREAENREKDAQIADLLKQVKALQEEIASLSNNS
EGQLKQLQEKLKQKTLEFEDSKRTLIEDYSNQLSAQEKKYLQQIEDLKRDYEQKIRQLTQ
ENSQKEASLIQKYEEQLKKLRDEMDEQKRQYENNAGSMEKKLQQTIEKQQEQINGLNKQI
TELQTRIQNLENTINQKDLDINQRDSMIQSLKQTISDLEIKFQQQNADGSSRQRELEIEI
QNLKKSLEDQERKYRDEIERLKNNANGELSDTIARMRIQYEGEMNAMRSQHQSEITRLER
QKNEEIKNLRDQLNLLKEQMQNDSSDLLSKLKQREQEYEDQIKQINQRHNYELKLIEEKN
QQMLNQTKTYYEDELKKLREQLEFEKTKALQKLQDEKEAEIAKLKQTHEDKLTSLSKNFD
KQLAERQQEFETKMKLLQKKVEDEEKAHFSTKEELKTTQTNLTDQISQNKDLKQKTDKQI
FDMSAEIKALKQQMEELIQQQTEALLARDQQVEGIKRDYQRKEEEVLRKANELVNRKIAE
QLEFIEQMKIEFNQVESALTEKYVRLENDYNDLQQMFEDRPSRPEDIETIKLLQAEIMRK
EQEIGKLNEQMKFFKLELINRENNYNKMFNANPNVGVMNPLDQKGQTAMRVLPQSNKLIS
QTSGLISGGQKRPSKNNV


>TTHERM_01321540(gene)
ATGGCGGAGAACTTGTCTGACTTGCACCACAAAATGTGCAAAAAAGTAGCATAATTAACC
AAGGTTATATTCTTTTTGAATACGAAGAACGATGAGTATGAGTAGAATCTCAAAGCAGTA
GTTTAAGCTTACGAGCAATAATTAGACTAAACAGTAAAAGAAGGCAATTAGATTATTACC
AAATACAAAGAGGCTCTAGACAAGGCTTCTAAGAACGAAGATTTAGCTAATTAGGTGATG
AAGATGAAACAGCAAATAGATCAAGAGAAGCAATAAAGTCAACAAGAGTTTACCAAATAC
AAACAGAAATGCGAAGAAAAAGAAGGTTAGTTAATTAGGGAATGTGCAAAGAAAATTGAC
ACTTACAAACAAGAATGCGAAGGGTTCAAAGTTAAAATTGAATAATTAACTACAAACCTC
GATAAGGTGATCAACAACTCAGAGTCGAATAAAAAAAACCACCAAAAGGAACTTGCAGAT
TATGTCAAAGAACAAAATGAAAAATACAACGACTTACTCAAAAAAAAGTTAGATTTAGAA
GATCAGTTAGAAAAACGCGACGCCGAAATCGCCCAACTTAAAAAAAAAATTGATGAATTA
AACAAAAAAATCATGGACGACTTGAAGAATCAAAAGGGATAATCCTAACAAATGCTTGAA
GAACTTGTAACAAACAAAAAATCTTTCTTTTTTAAAAAATAAATTCAAACTTTCTATTTA
TTTTTAATGACGAAACCAATCTATGCTTTGATAAATTAATTGATATCTAACTTGACTTTT
AATAAATCAAATCAAATCAAATATCAGTAGCTTATTTTTCTATCTTATTTAGTCTTTTCA
GATGAAAGAAAATCACCATATTTTAAAAATTTAAATAAAGCAATTTGTTGAACTTAAAAC
TTTTTTCAATAAAAATGATTTTATTCAATTCAAAAATAAATTTTAAAGTTGAAAAGGTGT
TTTTTAGGATTTTTAGATAAAATATTCCCTTTGAAAATCAATAACTGAATCATTTATTCA
AAAAAATAAACGAAAATTTTTTAAATTAATTGATTTTCTTCGGATAACATCAAAAACCAT
AAACGAAAAATTGTTGTTTTTCTTAAGAATATTTAAAGTAAAGCAAAAAAATGTTTCAAA
ATAAAGAGTTTTATAATGTGATAATATATTTAGATTGAATATTTATCAATTTAAAAGAAA
ATATCAGTGGAATTAATTCTTCAACATTTTTAATTTGTTCGTTTATTAATTATTAATATC
TGATCAAAAATTTATTGCAAAGAATTAATTTTAAAATAAAATAATTTAGATTGGTAGAAT
TATAAAATTTTGAATAAATATTTTAATTAAAATTTTTATAATAGCAAAATTTATTTAAAA
TTAAAAAATATATTTTTTTTTAAATAGAAAAAAAATTATGAGAACAAAATTGCTGATTTA
GAAGGAAAGAATAAAGAATTACTTTAAAAAATACAATCTCTTGAAGCTGAAATCTAATCG
CTTCGTATGTAGTTAAATAATAGGGAAACTGAATTAAAGACTGTTTCAGATGAGAGAAAC
TAACTCAAGAAAATGACTGAGAGATAAGCTCTGCAAATTTAAGAATAACAAAAAGAAATT
GATGGGTTGAAGGTCGAAAAACAACAAAATTTTGAAAAAATCAAGCAGTTAGAAGTATTT
TTTTTTTTTTGGATTTATCAAATATTGAAGAATATATTTAAAAGGCTGCAAATCAAGCAC
TTGAAAAGAAAATTAAAGACTATTAAGATTAGTTAGATAAATATGGTAAGGATAATAACA
TGAAAGACTCTGAAATCGGAACTTTAAGAAAGTAGTTTGAGAAGACTTTGTTTGATAAAA
ATGAAGAAATTAAAGGCGTACGCGCTTAATTGATGGAACTTTAAAAGCAATATGATTTAT
TATAAATTCAATTAAAAACTACTTAAGCCGAAAGAGAAGCTGAAAATAGAGAAAAGGATG
CATAAATTGCTGATCTGTTGAAGCAAGTTAAAGCTCTTCAAGAAGAAATAGCTAGTCTTT
CTAACAACTCTGAAGGACAACTCAAATAACTTCAAGAAGTAAATTTATTGAATAAAAGAA
AAATATTTTAAATCTGTTTTTTTAATATTTCATAGAAACTTAAACAAAAAACACTTGAGT
TTGAAGATTCTAAAAGAACTCTTATTGAAGATTACTCTAATCAACTCTCTGCTTAAGAAA
AGAAATACTTGTAACAAATAGAAGACTTAAAGAGAGACTATGAGCAAAAGATACGTTAGT
TGACTTAAGAAAATTCCTAAAAAGAAGCAAGCTTAATATAAAAGTACGAAGAATAATTAA
AAGTAATTTTAAAATTCATTTATTTTAAATGATTTTAATTTAAAAAAAACATTGTTTTAT
AAAAGAAACTCAGAGATGAGATGGATGAATAAAAGAGATAATACGAGAACAATGCCGGTT
CTATGGAAAAGAAGCTACAATAAACTATTGAAAAACAACAAGAATAAATTAATGGCTTGA
ACAAATAAATTACTGAGCTTTAAACAAGAATCTAAAACTTAGAGAATACAATTAACTAGA
AAGACTTGGATGTATTTATTTATTTTAACATTGAATTCATTTATTTACTAACAAACTAAC
TAATTTACTTATTTATTTAAATACTAATTTATTTATTTGCTCTTTAGATTTTATTTTAAA
TTAATTTGAATTTTTTAACAGATAAATCAAAGAGACTCAATGATTTAATCTCTGAAGTAA
ACTATATCAGATCTTGAGATTAAATTTTAATAGCAAAATGCAGATGGTTCTTCAAGATAA
AGGGAACTTGAAATTGAAATTTAGAATCTCAAAAAGTCTCTTGAAGACCAAGAAAGAAAA
TACAGAGATGAGATAGAAAGACTAAAAAATAATGCTAATGGTGAGCTTTCTGATACTATT
GCTCGTATGAGAATCCAATATGAGGGAGAAATGAATGCTATGAGATCTTAACATTAGTCA
GAAATTACAAGATTAGAAGTAATTTTTATTTTAAAGTTTATTTGTTTTAATGTTTGTTTT
AATTTTTTTATTTTAAAGAGACAAAAAAATGAAGAAATAAAAAATTTGAGGGATTAGCTT
AATTTGCTTAAAGAATAAATGCAAAATGATAGCTCTGACTTGCTTTCTAAACTTAAACAG
AGAGAACAAGAATACGAAGATTAAATAAAACAAATAAACCAAAGACACAACTATGAACTT
AAGTTGATTGAAGAAAAGAACTAGCAAATGCTAAATCAAACTAAGACTTATTATGAAGAC
GAGCTGAAGAAATTGAGAGAATAACTTGAGTTTGAAAAAACCAAAGCTCTTTAGAAATTA
CAAGATGAGAAGGAAGCTGAAGTAATTTATTAATTTAAAATAAAACTTTATTTTATTGTA
ATATGCTTTCATTTGAATGAAATAGATTGCTAAACTTAAATAAACTCACGAAGATAAATT
GACTTCACTTTCCAAGAATTTCGATAAATAACTTGCTGAACGTCAACAAGAATTTGAAAC
TAAGATGAAACTTCTTTAGAAGAAAGTTGAGGATGAGGAAAAAGCTCATTTCTCTACTAA
GGAAGAACTCAAAACAACTTAAACTAATCTTACTGATCAAATTAGCTAAAACAAAGACTT
AAAACAAAAAACAGACAAATAAATTTTTGATATGTCTGCTGAAATCAAGGCATTAAAGCA
ATAAATGGAAGAACTCATCTAATAATAGACAGAGGCTTTACTTGCCAGAGATCAATAAGT
CGAAGGTATCAAGAGAGATTATCAAAGAAAAGAAGTAAATAATAAAATTTAAATTAAATT
TTAAAGTTAAAAAATATCAAATTTTTAATAAAATTAATAAAAAATTAAATTTTAAATAAA
AATAGGAAGAAGTATTGAGAAAAGCTAACGAGTTGGTGAATAGAAAAATAGCCGAACAAC
TAGAATTCATTGAGCAAATGAAGATTGAATTCAACTAGGTAGAATCTGCTTTGACAGAGA
AATATGTTCGCTTAGAAAATGAGTATTTTTTTATTTTAAATAATTGATAAAATTAATATT
TTTATTGAATGTAAAGCTATAATGATCTCCAATAAATGTTTGAAGATAGACCTTCAAGAC
CAGAAGATATCGAAACAATTAAGTTGTTGCAAGCTGAAATCATGAGAAAGGAACAAGAAA
TAGGAAAACTTAATGAACAAATGAAATTCTTCAAGCTAGAATTAATTAACAGAGAAAACA
ACTATAATAAGATGTTCAACGCTAATCCTAATGTAGGTGTTATGAACCCTTTAGATTAAA
AAGTAATTAATTTATTTATTCATTTACTTATTCTTATGTTTTGCAATTAAATTTTTATGT
ATTAAATTTAAAGGGATAAACAGCTATGAGAGTACTACCTTAAAGCAACAAGCTAATAAG
CTAAACATCTGGACTGATTAGCGGAGGACAAAAAAGACCTAGCAAGAATAACGTTTGA