Identifiers and Description

Gene Model Identifier

TTHERM_01318430

Standard Name

None

Aliases

PreTt19017 | 323.m00015

Description

eukaryotic translation initiation factor 5A; translation initiation factor eIF-5A family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00467 ) KOW motif
  • ( TIGR00037 ) translation initiation factor eIF-5A
  • ( PF01287 ) Eukaryotic initiation factor 5A hypusine,

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01318430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05485.15.000729663236884e-95translation initiation factor
eIF-5A family protein (161 aa)
SGDYJR047C6.998985483803218e-56ANB1 Translation elongation fa
ctor eIF-5A, previously though
t to function in translation i
nitiation; similar to and func
tionally redundant with Hyp2p;
undergoes an essential hypusi
nation modification; expressed
under anaerobic conditions
DictyBaseDDB_G02848611.0000844672813518e-48eif5a on chromosome: 4 positio
n 2766075 to 2766554
WormBaseWBGene000020651.999683289470905e-41locus:iff-2 Eukaryotic trans
lation initiation factor 5A-2
status:Confirmed UniProt:Q
20751 protein_id:CAA90247.1
OxytrichaContig1970.0.g234.9998290395614495e-40Eukaryotic elongation factor 5
A hypusine, DNA-binding OB fol
d
Stentor CoeruleusSteCoe_81561.4251640827409352e-21

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01318430(coding)
ATGTCTGACTACGAACATTACGACTAAGGAGAATCTGGTTCTTCTTTAACTTATCCAATG
TAAGCTGGTAATGTTAAAAAAAATGGATATGCCATGCTAAGAGGTTTCCCTTGTAGAGTT
ACTGAAATGACAACTTGTAAGGCAGGAAAGCATGGACACGCAAAGGCTACTATCATTGGA
ATTGATATTTTCTCAGGCAAAAAATATGAAGACTCATGTCCAACTTCACATAATATGGAA
ATACCATTTGTAAAGAAACATGAATTCTAATTGATAGATATATCAGATGATGACTATCTC
ACTCTTTTGCTTGAAAACGGAGAAACCAAGGAAGATCTTAAACTTCCTGACGATGAACCA
CAATTAGTAGAAAAACTTAGAGCAGATTTCGATAGTCAAAAGGATATTCTTGTCTCTATA
ATATCAGCTATGGGATAAGAAAAAATTATTTCTTACAGAGAAATAGTTAATTGA


>TTHERM_01318430(protein)
MSDYEHYDQGESGSSLTYPMQAGNVKKNGYAMLRGFPCRVTEMTTCKAGKHGHAKATIIG
IDIFSGKKYEDSCPTSHNMEIPFVKKHEFQLIDISDDDYLTLLLENGETKEDLKLPDDEP
QLVEKLRADFDSQKDILVSIISAMGQEKIISYREIVN


>TTHERM_01318430(gene)
ATGTCTGACTACGAACATTACGACTAAGGAGAATCTGGTTCTTCTTTAACTTATCCAATG
TAAGCTGGTAATGTTAAAAAAAATGGATATGCCATGCTAAGAGGTTTCCCTTGTAGAGTT
ACTGAAATGACAACTTGTAAGGCAGGAAAGCATGGACACGCAAAGGCTACTATCATTGGA
ATTGATATTTTCTCAGGCAAAAAATATGAAGACTCATGTCCAACTTCACATAATATGGAA
ATACCATTTGTAAAGAAACATGAATTCTAATTGATAGATATATCAGATGATGACTATCTC
ACTCTTTTGCTTGAAAACGGAGAAACCAAGGAAGATCTTAAACTTCCTGACGATGAACCA
CAATTAGTAGAAAAACTTAGAGCAGATTTCGATAGTCAAAAGGATATTCTTGTCTCTATA
ATATCAGCTATGGGATAAGAAAAAATTATTTCTTACAGAGAAATAGTTAATTGA