Identifiers and Description

Gene Model Identifier

TTHERM_01309090

Standard Name

None

Aliases

PreTt09132 | 319.m00014

Description

DNA / pantothenate metabolism flavoprotein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR02114 ) phosphopantothenate--cysteine ligase
  • ( PF04127 ) DNA / pantothenate metabolism flavoprotein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01309090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig19376.0.g821.0000099287337047e-53DNA / pantothenate metabolism
flavoprotein
DictyBaseDDB_G02826114.000139296874041e-45DDB_G0282611 on chromosome: 3
position 6001079 to 6002350
SGDYIL083C2.0008536325002377e-42CAB2 Probable phosphopantothen
oylcysteine synthetase (PPCS),
which catalyzes the second st
ep of coenzyme A biosynthesis
from pantothenate; null mutant
lethality is complemented by
E. coli coaBC (encoding a bifu
nctional enzyme with PPCS acti
vity)
WormBaseWBGene000221719.999888128184441e-42status:Confirmed UniProt:Q9B
L36 protein_id:CCD73864.1
Tetrahymena borealisEI9_20977.12.0003218023735366e-33hypothetical protein (169 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01309090(coding)
ATGTGTGACATTTTCTCAATCAGTGATTTTTAAAAAAATGAATTAGATGAAAACTAAAGA
AAAGAAGCAGAATTTATTAGACAATAAGTCGAAAATTAAATTTTAGAGTGGTAAAAATTA
GATATCAATACAAAAATTGTATGTATTACCTCAGGAGGTACTTCTGTGCCATTAGAAAAA
AATACTGTTAGATCTATTGAGAACTTTTCTACAGGATAAAGAGGTGCTATCTCTGCTGAA
GAATTTCTAAAAAGAGGATACAAAGTTATCTTTTTAAATAGAAAAAAATCATTGTAACCT
TTTTGCTGGAAGTATTAAGTGGAAAAGATATTTGACTAAGGGTTTGATTTATGTTAGCAG
GATGTATAACTTTATCAAAATTATAAATCCTCTATCCTAAAAATATCTTTCGAAAAAGTC
TAAGATTATCTCTCTTTAGTATTGGTGATATCAGAATGTATTGGTAAAAATCCTTACAGC
AAAAATATGGCTATATACTTAGCTGCAGCCGTCAGTGATTTTTATATCCCAATTGATAAA
ATGGTTTCTCACAAAATTCAGTCAACAGATAATGAATAAGGATTAGTAGTTAAACTTGAT
AATGTACCAAAGTGCTTAAAAAAAATAAAAGAATTGGCAAATGAAGCAAAGGTGATATCT
TTTAAACTTGAAACAGACAATACAATACTTAAAGATAAAGTTTTATCTTCTTTTAAAAAA
TATGGAGTTGATATTATCATTGGAAATCTTCTAAGCAATACCAGATTCGAGGTCTATTTA
TATTAAAAGATATCAGAAACAAATAATATAGATAAAGATATACTTTGTGAACATATTAAA
TAAGAGAAAGATTCTGATCAACTCATAGAATCAAAGCTCATTGAATCATTAGTTAAGAGA
CTTGAAGCTTATTGA


>TTHERM_01309090(protein)
MCDIFSISDFQKNELDENQRKEAEFIRQQVENQILEWQKLDINTKIVCITSGGTSVPLEK
NTVRSIENFSTGQRGAISAEEFLKRGYKVIFLNRKKSLQPFCWKYQVEKIFDQGFDLCQQ
DVQLYQNYKSSILKISFEKVQDYLSLVLVISECIGKNPYSKNMAIYLAAAVSDFYIPIDK
MVSHKIQSTDNEQGLVVKLDNVPKCLKKIKELANEAKVISFKLETDNTILKDKVLSSFKK
YGVDIIIGNLLSNTRFEVYLYQKISETNNIDKDILCEHIKQEKDSDQLIESKLIESLVKR
LEAY


>TTHERM_01309090(gene)
ATGTGTGACATTTTCTCAATCAGTGATTTTTAAAAAAATGAATTAGATGAAAACTAAAGA
AAAGAAGCAGAATTTATTAGACAATAAGTCGAAAATTAAATTTTAGAGTGGTAAAAATTA
GATATCAATACAAAAATTGTATGTATTACCTCAGGAGGTACTTCTGTGCCATTAGAAAAA
AATACTGTTAGATCTATTGAGAACTTTTCTACAGGATAAAGAGGTGCTATCTCTGCTGAG
TAAAAACAAATTTTAATAAAAATTTTTTTAAATCTTAATTAATAAAAATTAGAGAATTTC
TAAAAAGAGGATACAAAGTTATCTTTTTAAATAGAAAAAAATCATTGTAACCTTTTTGCT
GGAAGTATTAAGTGGAAAAGTAATCTTGATTTCAATAAAATTTTTTTGTTTTATGAATAA
TATTATTAAAAACTTTAATTTGGAAATTTTCAACAATAATAAAATTTTTAATTTCATTTA
AAAAAGGATATTTGACTAAGGGTTTGATTTATGTTAGCAGGATGTATAACTTTATCAAAA
TTATAAATCCTCTATCCTAAAAATATCTTTCGAAAAAGTCTAAGATTATCTCTCTTTAGT
ATTGTAACCTAACCTTTATTTACCCCTTATTTTATTTTACTTATTATATGAATTGTATTA
ATTTAGGGTGATATCAGAATGTATTGGTAAAAATCCTTACAGCAAAAATATGGCTATATA
CTTAGCTGCAGCCGTCAGTGATTTTTATATCCCAATTGATAAAATGGTAAATTAATATCT
ACTCATAATATAAAGTTTTAATTAACTTTAAATACTGATAAAATCAAGGTTTCTCACAAA
ATTCAGTCAACAGATAATGAATAAGGATTAGTAGTTAAACTTGATAATGTACCAAAGTGC
TTGTAAGCTTCTTTTTTTAATAGTTAATAATACTTTTAACTTATATATATTATAAAAAGA
AAAAAAATAAAAGAATTGGCAAATGAAGCAAAGGTGATATCTTTTAAACTTGAAACAGAC
AATACAATACTTAAAGATAAAGTTTTATCTTCTTTTAAAAAATATGGAGTTGATATTGTA
ACTAATTACTATATTTAATATTTTATTTAAATTTTAAAAAAATTTATTTTTAGATCATTG
GAAATCTTCTAAGCAATACCAGATTCGAGGTCTATTTATATTAAAAGATATCAGAAACAA
ATAATATAGATAAAGATATACTTTGTGAACATATTAAATAAGAGAAAGATTCTGATCAAG
TAAATAATTATTTTTATTATAAATAAATATCTTATTTGTTAAAATTATATTTTATTAAAA
ATCCAGCTCATAGAATCAAAGCTCATTGAATCATTAGTTAAGAGACTTGAAGCTTATTGA