Identifiers and Description

Gene Model Identifier

TTHERM_01289110

Standard Name

RPL15 (Ribosomal protein of the large subunit)

Aliases

PreTt20220 | PreTt20221 | 310.m00045 | RPL15e

Description

Homolog of yeast RPL15 (/RPL15e)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20962.17.00054185695683e-135ribosomal protein L15 (205...
OxytrichaContig10140.0.g477.00114198504521e-89Ribosomal L15
ParameciumDBGSPATP000167900013.00148023798786e-60Paramecium tetraurelia GSPATP0
0016790001 protein
ParameciumDBGSPATP000120480013.00148023798786e-60Paramecium tetraurelia GSPATP0
0012048001 protein
ParameciumDBGSPATP000338880013.00148023798786e-60Paramecium tetraurelia GSPATP0
0033888001 protein
ParameciumDBGSPATP000325490013.00148023798786e-60Paramecium tetraurelia GSPATP0
0032549001 protein
ToxoDB42.m001117.00017671442579e-58Toxoplasma gondii ribosomal pr
otein L15, putative
TAIRAT4G167209.00113158105093e-5760S ribosomal protein L15 (RPL
15A)
IPI(HUMAN)IPI:IPI00382749.11.00018013089414e-55Tax_Id=9606 Ribosomal protein
L15
PlasmoDBPFD0770c1.00018013089414e-55Plasmodium falciparum PFD0770c
DictyBaseDDB02174049.99595103671115e-55JC2V2_0_01443
DictyBaseDDB02029989.99595103671115e-55rpl15 ribosomal protein L15
SGDYLR029C3.00068243969355e-51RPL15A SGDID:S000004019, Chr X
II from 202591-201977, reverse
complement, Verified ORF, "Pr
otein component of the large (
60S) ribosomal subunit, nearly
identical to Rpl15Bp and has
similarity to rat L15 ribosoma
l protein; binds to 5.8 S rRNA
"
CryptoDBEAK873746.99950717283637e-51Cryptosporidium parvum (Iowa)
protein EAK87374
WormBaseK11H12.25.99990773576909e-44WBGene00004427 rpl-15 60S ribo
somal protein L15

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_01289110(protein)
MGAYKYLEELWRKKQSDLMSFILRLRTWEYRQLPVIHKASRSSRPDKARKLGYKNKDGYA
IWRVRVRRGGRKRPVSKGIVYGKPSSVGINQLKFARNLRSCAEERVGKRVPELRVLNSYW
VGQDGTYKFYEVILADPSHNAIRNDPRINWICESAHKHRELRGLTSAGRKGRGLRVKGHR
AKSLRTSRKGNWRARQMLKLRRYR


>TTHERM_01289110(coding)
ATGGGTGCCTACAAATATTTGGAAGAATTATGGAGAAAGAAGCAATCTGATCTCATGTCC
TTCATTTTGCGTCTTAGAACCTGGGAATACAGACAATTACCCGTCATCCACAAGGCTTCT
AGATCCTCCAGACCCGACAAGGCTAGAAAGTTGGGTTACAAGAACAAGGATGGTTACGCT
ATCTGGAGAGTCAGAGTCAGAAGAGGTGGTAGAAAGAGACCTGTCTCCAAGGGTATCGTT
TACGGTAAGCCCTCCAGTGTTGGTATCAACCAATTGAAGTTCGCCAGAAACCTCAGATCT
TGCGCTGAAGAAAGAGTCGGTAAGAGAGTCCCTGAATTAAGAGTCCTCAACTCTTACTGG
GTTGGTCAAGACGGTACCTACAAGTTCTACGAAGTTATCCTCGCTGATCCCTCTCACAAC
GCCATCAGAAACGACCCCAGAATCAACTGGATCTGTGAATCTGCTCACAAGCACAGAGAA
TTAAGAGGTCTTACCTCCGCTGGTAGAAAGGGTAGAGGTCTCAGAGTTAAGGGCCACAGA
GCTAAATCTCTCAGAACCTCCAGAAAGGGTAACTGGAGAGCTAGACAAATGCTCAAGCTC
AGAAGATACCGTTGA


>TTHERM_01289110(gene)
AAAAATCAAAAAAGAGTAAAATTAATTAAAAGTAAAAAGTAAAAGCAATTAGAAATGGGT
GCCTACAAATATTTGGAAGAATTATGGAGAAAGAAGCAATCTGATCTCATGTCCTTCATT
TTGCGTCTTAGAACCTGGGAATACAGACAATTACCCGTCATCCACAAGGCTTCTAGATCC
TCCAGACCCGACAAGGCTAGAAAGTTGGGTTACAAGAACAAGGATGGTTACGCTATCTGG
AGAGTCAGAGTCAGAAGAGGTGGTAGAAAGAGACCTGTCTCCAAGGGTATCGTTTACGGT
AAGCCCTCCAGTGTTGGTATCAACCAATTGAAGTTCGCCAGAAACCTCAGATCTTGCGCT
GAAGAAAGAGTCGGTAAGAGAGTCCCTGAATTAAGAGTCCTCAACTCTTACTGGGTTGGT
CAAGACGGTACCTACAAGTTCTACGAAGTTATCCTCGCTGATCCCTCTCACAACGCCATC
AGAAACGACCCCAGAATCAACTGGATCTGTGAATCTGCTCACAAGCACAGAGAATTAAGA
GGTAATTATCAAATTATTTAGCATTCTTAATAGAAAATTTTCTAGTTTTCATGATAGCTT
TGTTATTTATTCACTTGCTACTCGATTTAGATGCAAATCAATTTAAGTGGATGATAGTTA
ATTTGTTGATTTTAAAGAAAACACAAATTCTGAAAATAAACCTTAGCATGTGAATATAAA
ATGCAATTAAATTATTGTCCTAAGCATTTGAATTGCTTGATTAATGCTAATAAATTCACT
ATCTACTTTATATTAAGGGAGATTAGATTTGATATACTTGATAATTATACTATTTACTCA
ATTTTCCTTTTCGATCGATTGGTTTAGCTAACGATAATTTGCATGAATTTCTTTAATAAT
GAATTGATTCATTGATTGATTAAATACACATGAAATCATCAATATCTAAAGCATTGATAA
CCAAATGGAAAAAATTGAAGGATGTAGCATGAATAAAACAAAGCTAGATTGATAAACTTA
ATTTTAATAAAAAATTCATTTATTTATATTTAGTTTTAAAGTAAACTTGTTACTAATTAT
TTTTTTAACATTACAGGTCTTACCTCCGCTGGTAGAAAGGGTAGAGGTCTCAGAGTTAAG
GGCCACAGAGCTAAATCTCTCAGAACCTCCAGAAAGGGTAACTGGAGAGCTAGACAAATG
CTCAAGCTCAGAAGATACCGTTGAGCTGCTTGATAGTTTAACAACTTTCCAATACAATCA
ATACAAAACTGTTTATATACAATCAAAAATTAATATATATCACTTTATAACATGTAGGTT
AACATATTATCACTTATTTAAAATAACAACCCACTCAAAACCTTTCGCTCTCTATATATA
TACATACATACTTATTTTATTCTAAAATTATTCAAAATATCCT