Identifiers and Description

Gene Model Identifier

TTHERM_01289110

Standard Name

RPL15 (Ribosomal protein of the large subunit)

Aliases

PreTt20220 | PreTt20221 | 310.m00045 | RPL15e

Description

Homolog of yeast RPL15 (/RPL15e)

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20962.17.002403107011161e-144ribosomal protein L15 (205 aa)
DictyBaseDDB_G02728939.001701800865775e-93rpl15-1 on chromosome: 2 posit
ion 2395262 to 2396133
SGDYLR029C1.999022616705709e-90RPL15A Protein component of th
e large (60S) ribosomal subuni
t, nearly identical to Rpl15Bp
and has similarity to rat L15
ribosomal protein; binds to 5
.8 S rRNA
OxytrichaContig10140.0.g477.001141985045207e-89Ribosomal L15
WormBaseWBGene000044278.00275873087502e-68locus:rpl-15 60S ribosomal p
rotein L15 status:Confirmed
UniProt:P91374 protein_id:
CCD70971.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_01289110(protein)
MGAYKYLEELWRKKQSDLMSFILRLRTWEYRQLPVIHKASRSSRPDKARKLGYKNKDGYA
IWRVRVRRGGRKRPVSKGIVYGKPSSVGINQLKFARNLRSCAEERVGKRVPELRVLNSYW
VGQDGTYKFYEVILADPSHNAIRNDPRINWICESAHKHRELRGLTSAGRKGRGLRVKGHR
AKSLRTSRKGNWRARQMLKLRRYR


>TTHERM_01289110(coding)
ATGGGTGCCTACAAATATTTGGAAGAATTATGGAGAAAGAAGCAATCTGATCTCATGTCC
TTCATTTTGCGTCTTAGAACCTGGGAATACAGACAATTACCCGTCATCCACAAGGCTTCT
AGATCCTCCAGACCCGACAAGGCTAGAAAGTTGGGTTACAAGAACAAGGATGGTTACGCT
ATCTGGAGAGTCAGAGTCAGAAGAGGTGGTAGAAAGAGACCTGTCTCCAAGGGTATCGTT
TACGGTAAGCCCTCCAGTGTTGGTATCAACCAATTGAAGTTCGCCAGAAACCTCAGATCT
TGCGCTGAAGAAAGAGTCGGTAAGAGAGTCCCTGAATTAAGAGTCCTCAACTCTTACTGG
GTTGGTCAAGACGGTACCTACAAGTTCTACGAAGTTATCCTCGCTGATCCCTCTCACAAC
GCCATCAGAAACGACCCCAGAATCAACTGGATCTGTGAATCTGCTCACAAGCACAGAGAA
TTAAGAGGTCTTACCTCCGCTGGTAGAAAGGGTAGAGGTCTCAGAGTTAAGGGCCACAGA
GCTAAATCTCTCAGAACCTCCAGAAAGGGTAACTGGAGAGCTAGACAAATGCTCAAGCTC
AGAAGATACCGTTGA


>TTHERM_01289110(gene)
ATGGGTGCCTACAAATATTTGGAAGAATTATGGAGAAAGAAGCAATCTGATCTCATGTCC
TTCATTTTGCGTCTTAGAACCTGGGAATACAGACAATTACCCGTCATCCACAAGGCTTCT
AGATCCTCCAGACCCGACAAGGCTAGAAAGTTGGGTTACAAGAACAAGGATGGTTACGCT
ATCTGGAGAGTCAGAGTCAGAAGAGGTGGTAGAAAGAGACCTGTCTCCAAGGGTATCGTT
TACGGTAAGCCCTCCAGTGTTGGTATCAACCAATTGAAGTTCGCCAGAAACCTCAGATCT
TGCGCTGAAGAAAGAGTCGGTAAGAGAGTCCCTGAATTAAGAGTCCTCAACTCTTACTGG
GTTGGTCAAGACGGTACCTACAAGTTCTACGAAGTTATCCTCGCTGATCCCTCTCACAAC
GCCATCAGAAACGACCCCAGAATCAACTGGATCTGTGAATCTGCTCACAAGCACAGAGAA
TTAAGAGGTAATTATCAAATTATTTAGCATTCTTAATAGAAAATTTTCTAGTTTTCATGA
TAGCTTTGTTATTTATTCACTTGCTACTCGATTTAGATGCAAATCAATTTAAGTGGATGA
TAGTTAATTTGTTGATTTTAAAGAAAACACAAATTCTGAAAATAAACCTTAGCATGTGAA
TATAAAATGCAATTAAATTATTGTCCTAAGCATTTGAATTGCTTGATTAATGCTAATAAA
TTCACTATCTACTTTATATTAAGGGAGATTAGATTTGATATACTTGATAATTATACTATT
TACTCAATTTTCCTTTTCGATCGATTGGTTTAGCTAACGATAATTTGCATGAATTTCTTT
AATAATGAATTGATTCATTGATTGATTAAATACACATGAAATCATCAATATCTAAAGCAT
TGATAACCAAATGGAAAAAATTGAAGGATGTAGCATGAATAAAACAAAGCTAGATTGATA
AACTTAATTTTAATAAAAAATTCATTTATTTATATTTAGTTTTAAAGTAAACTTGTTACT
AATTATTTTTTTAACATTACAGGTCTTACCTCCGCTGGTAGAAAGGGTAGAGGTCTCAGA
GTTAAGGGCCACAGAGCTAAATCTCTCAGAACCTCCAGAAAGGGTAACTGGAGAGCTAGA
CAAATGCTCAAGCTCAGAAGATACCGTTGA