Identifiers and Description

Gene Model Identifier

TTHERM_01285910

Standard Name

ZFR1 (Zinc Finger-Related 1)

Aliases

PreTt19421 | 308.m00019

Description

Zinc finger protein; required for sexual development; localizes to conjugation junction

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00643 ) B-box zinc finger
  • ( PF04508 ) Viral A-type inclusion protein repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_01285910

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01442.19.004486704249587e-32hypothetical protein (307 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26688337: Kataoka K, Mochizuki K (2015) Phosphorylation of an HP1-like Protein Regulates Heterochromatin Body Assembly for DNA Elimination. Developmental cell 35(6):775-88
  2. Ref:23251712: Xu J, Tian H, Wang W, Liang A (2012) The zinc finger protein Zfr1p is localized specifically to conjugation junction and required for sexual development in Tetrahymena thermophila. PloS one 7(12):e52799

Sequences

>TTHERM_01285910(coding)
ATGTTAGAAATTATTAAAGAAATTTAAAGATATTGTTTAAAAATTAGTTTATTAGCTAGC
TAAGATATTTTCAGGTCAAAATACAATTAATTAATTAGCAAAGATAATTTAAGAATATAA
TACAATTATTAATTTATAATAATTTGTTATAAAAAATTTAAAAAGCTAAAAAAATTTGTA
AATAATCTGAAAAATAAAATGAGTTAAATCTGTAGTATTCATTAATCTGAATTTATCAGC
CTTTGTGTTGATAAGAGTTGCAGCAATAGAAGCCTCATCTGCTAAGTGTGTGCTAGAGAG
AGTCATATGACCCATGTAATAATCCCTTTTTAGGAGTTTTGTGACTTTCTATACAACGAT
ATAAAGGCTAGTTAAACCTAAAGCGAGTTTGGTAGAGACATCAAAAATTAAGAATAAGAA
ATAGCCTATTTATTAACTTAACTTGAGAAGATAATTAAATCTATGTAAACGCTCAAATCT
AGCTTATAAATAACACTCTTGGAATAAAATGACTTACAAAAGAGGTTTTTAGAAAGAAAA
TTAGAATAATTTTAACATCAGATTAAAATTGTGCTAACCAAATAAGAAGGATACCAGGAA
ATCATCCGAAATATTATTTCTGAGCCAGATAGCTATACATTAAATGACAACAATTATCTC
ATGCAAATCTAATTTACAGAAATCGAAGGTCTGAAAGAAAAGTTTAATGATTTTTCTGAG
CAGTTCAAGAAATATCGCTCTAATGTATGTGAATATTTTTAACAAATTGAAGATGCTTTG
AATAAAGTATCAGCTTTTAAAGGCCCATAAATTGAAGAGTTAGACGAGAGCTTTTTAAAT
TATCAAAGCCATATTTCTCAGCAAAAAAGTTTATATTAAAATAAAAGAATTTATGAGCAA
GCAAATGTTTTAGAAACAGACAGAATCAATTGGAAAAATCGCTCTGTGATATCAGCAAGT
AATACCAATAATCCTCCAAGAGATGATTTCTAAAGTTCAGGCCTTAATCTTCGAAATTCA
TCTCAAAAGTTGACTAGAGAAGAATATTAAAATTAGATGCTATCGCCTTAGTAGAATGTT
TGTAAATTTAGATTCTAGCCTAATAACAAGAAAGAATTTCAAAGTGCTATGTAAGAAATT
ATTGGCAATTAGGGAATAAAGAGTCTATGGATTGATTTCCCTATTGACTCAGGAATCAAC
GAGATAAGATACTTGATCTAGGTCCTGAAATTGAAGCAAAACATCAAAAAGATCTTTTTA
AATTTTCCTAAGAGCATCACAATAAATAGCTTGGCATTTTAAGGATTGTTTGATTGTCTT
AAGAATTTAAGCAGTGTTGAAATATTATCATTAAAAATGAAAAAATGCTAAATAGAAGCC
TAATTCTCTTGGGATACTCTTTTAGATTCAATCTACTATCTTTCAAAGAAAAATTTACAA
AGGGTTTTACTTTTAGTCAGTGATTAAACAGGTAAAGAGATTAAGCAAAGAATATCCTAT
AGACCTCATTCGAATATTTTATATGAATTGATTGACTTTAATTGA


>TTHERM_01285910(protein)
MLEIIKEIQRYCLKISLLASQDIFRSKYNQLISKDNLRIQYNYQFIIICYKKFKKLKKFV
NNLKNKMSQICSIHQSEFISLCVDKSCSNRSLICQVCARESHMTHVIIPFQEFCDFLYND
IKASQTQSEFGRDIKNQEQEIAYLLTQLEKIIKSMQTLKSSLQITLLEQNDLQKRFLERK
LEQFQHQIKIVLTKQEGYQEIIRNIISEPDSYTLNDNNYLMQIQFTEIEGLKEKFNDFSE
QFKKYRSNVCEYFQQIEDALNKVSAFKGPQIEELDESFLNYQSHISQQKSLYQNKRIYEQ
ANVLETDRINWKNRSVISASNTNNPPRDDFQSSGLNLRNSSQKLTREEYQNQMLSPQQNV
CKFRFQPNNKKEFQSAMQEIIGNQGIKSLWIDFPIDSGINEIRYLIQVLKLKQNIKKIFL
NFPKSITINSLAFQGLFDCLKNLSSVEILSLKMKKCQIEAQFSWDTLLDSIYYLSKKNLQ
RVLLLVSDQTGKEIKQRISYRPHSNILYELIDFN


>TTHERM_01285910(gene)
CAAATAACTAACTATTGAATTCTAATTTATAATCAATAAATCACAAAAATATTTTATTTA
TGTTAGAAATTATTAAAGAAATTTAAAGATATTGTTTAAAAATTAGTTTATTAGCTAGCT
AAGATATTTTCAGGTCAAAATACAATTAATTAATTAGCAAAGATAATTTAAGAATATAAT
ACAATTATTAATTTATAATAATTTGTTATAAAAAATTTAAAAAGCTAAAAAAATTTGTAA
ATAATCTGAAAAATAAAATGAGTTAAATCTGTAGTATTCATTAATCTGAATTTATCAGCC
TTTGTGTTGATAAGAGTTGCAGCAATAGAAGCCTCATCTGCTAAGTGTGTGCTAGAGAGA
GTCATATGACCCATGTAATAATCCCTTTTTAGGAGTTTTGTGACTTTCTATACAACGATA
TAAAGGCTAGTTAAACCTAAAGCGAGTTTGGTAGAGACATCAAAAATTAAGAAGTAAAAT
ATATTTATTTATTTATTTAAAATAATTTTTTAAATTACTTTTATATATACAATAGTAAGA
AATAGCCTATTTATTAACTTAACTTGAGAAGATAATTAAATCTATGTAAACGCTCAAATC
TAGCTTATAAATAACACTCTTGGAATAAAATGACTTACAAAAGAGGTTTTTAGAAAGAAA
ATTAGAATAATTTTAACATCAGATTAAAATTGTGCTAACCAAATAAGAAGGATACCAGGA
AATCATCCGAAATATTATTTCTGAGCCAGATAGCTATACATTAAATGACAACAATTATCT
CATGCAAATCTAATTTACAGAAATCGAAGGTCTGAAAGAAAAGTTTAATGATTTTTCTGA
GCAGTTCAAGAAATATCGCTCTAATGTATGTGAATATTTTTAACAAATTGAAGATGCTTT
GAATAAAGTATCAGCTTTTAAAGGCCCATAAATTGAAGAGTTAGACGAGAGCTTTTTAAA
TTATCAAAGCCATATTTCTCAGCAAAAAAGTTTATATTAAAATAAAAGAATTTATGAGCA
AGCAAATGTTTTAGAAACAGACAGAATCAATTGGAAAAATCGCTCTGTGATATCAGCAAG
TAATACCAATAATCCTCCAAGAGATGATTTCTAAAGTTCAGGCCTTAATCTTCGAAATTC
ATCTCAAAAGTTGACTAGAGAAGAATATTAAAATTAGATGCTATCGCCTTAGTAGAATGT
TTGTAAATTTAGATTCTAGCCTAATAACAAGAAAGAATTTCAAAGTGCTATGTAAGAAAT
TATTGGCAATTAGGGAATAAAGAGTCTATGGATTGATTTCCCTATTGACTCAGGAATCAA
CGAGATAAGATACTTGATCTAGGTCCTGAAATTGAAGCAAAACATCAAAAAGATCTTTTT
AAATTTTCCTAAGTAAATTTAATTTAACACAATTGCTAGAATATTTTTTAGATAATAACT
TCTACTTTTATTTAATAAAGGAGCATCACAATAAATAGCTTGGCATTTTAAGGATTGTTT
GATTGTCTTAAGAATTTAAGCAGTGTTGAAATATTATCATTAAAAATGAAAAAGTAAAAT
AAAGAGATAAAATATTTGTTTTTTTTGATGATAATTTTTTTATAAATAAAATAGATGCTA
AATAGAAGCCTAATTCTCTTGGGATACTCTTTTAGATTCAATCTACTATCTTTCAAAGAA
AAATTTACAAAGGGTTTTACTTTTAGTCAGTGATTAAACAGGTAAAGAGATTAAGCAAAG
AATATCCTATAGACCTCATTCGAATATTTTATATGAATTGATTGACTTTAATTGAAGATA
AAATTAAGTTCTATCTATGTTCATGAACAATTTAAAATAAATTTATTAGTTATAATCAAT
ATTTTTTTATTTTTTGTGATTAAACATTTTCGTGAATTTATTCAATGATAATATTCAATG
TAATATTTTAGTTCGCTAATGTTTAAAATTGTTTTATTTGAC