Identifiers and Description

Gene Model Identifier

TTHERM_01248890

Standard Name

None

Aliases

PreTt04484 | 291.m00025

Description

Cyclin-dependent kinase regulatory subunit family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

  • cyclin-dependent protein serine/threonine kinase regulator activity (IEA) | GO:0016538

Biological Process

Domains

  • ( PF01111 ) Cyclin-dependent kinase regulatory subunit

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_01248890

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02384.12.9986404383886433e-43hypothetical protein (93 aa)
OxytrichaContig15320.0.g741.999683289470905e-41Cyclin-dependent kinase regula
tory subunit
DictyBaseDDB_G02716423.999672240330216e-26cks1 on chromosome: 2 position
614231 to 614775
SGDYBR135W4.998021988471165e-24CKS1 Cyclin-dependent protein
kinase regulatory subunit and
adaptor; modulates proteolysis
of M-phase targets through in
teractions with the proteasome
; role in transcriptional regu
lation, recruiting proteasomal
subunits to target gene promo
ters
WormBaseWBGene000010515.9971655715910366e-21locus:cks-1 Cyclin-dependent
kinases regulatory subunit
status:Confirmed UniProt:Q17
868 protein_id:CCD63999.1
Stentor CoeruleusSteCoe_67782.1151310375910805e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01248890(coding)
ATGCCTAGGTTTCCAAATGAGATTTAATACGGAGAAAAATACTATGATGATTATTATGAA
TATAGACACGTTATCCTTCCAAAGCAGATATTTAAAACTATGCCAAGAGATTAAAAAGTT
TTGACAGAAAGTTAGTGGAGAATGATGGGAATATAGCAAAGTAGAGGATGGGTGCATTAT
GACTCACATAAGCCTGAACCTTATATTCTTCTATTTAGACGCCCTAAAGGAACTGATCCT
TAAACAGGAATTCCTCCTAGAGGATTTAAAGATCCAGATTTTTTAGAATCATAGTAAAAC
GAATAATAATAAATGTAGTAAGATGAATCTTCGATATAGTTATAGCAACAAGTAGAATAA
AACCAAAGACAAAACCTTAATTAAAATATATTTTTAAGAAAAAATGTTTAAAAATACAAC
AGATACGACTTTTTCAATAACACATAATGA


>TTHERM_01248890(protein)
MPRFPNEIQYGEKYYDDYYEYRHVILPKQIFKTMPRDQKVLTESQWRMMGIQQSRGWVHY
DSHKPEPYILLFRRPKGTDPQTGIPPRGFKDPDFLESQQNEQQQMQQDESSIQLQQQVEQ
NQRQNLNQNIFLRKNVQKYNRYDFFNNTQ


>TTHERM_01248890(gene)
TTGAGGGATTATTCATTCATTAATTTTTTTGCTTATTTTTTATAATATAGATCAGTTCAA
AAAAAATAATCAACTCTTCTTATAGTAATACAATTTTTTAATAGAAGAAAACAATCAAAT
ATTTTTAGGAAAGCTAAACACGCAAATAAATAAATAAATAAATAAATAAAAATAGATAAG
ATGCCTAGGTTTCCAAATGAGATTTAATACGGAGAAAAATACTATGATGATTATTATGAA
TATAGACACGTTATCCTTCCAAAGCAGATATTTAAAACTATGCCAAGAGATTAAAAAGTT
TTGACAGAAAGTTAGTGGAGAATGATGGGAATATAGCAAAGTAGAGGTAATATTATTTGC
CATTCAAAAAATTATAATAAAAAGCATTTTCATTATAAATTTAAAGGATGGGTGCATTAT
GACTCACATAAGCCTGAACCTTATATTCTTCTATTTAGACGCCCTAAAGGAACTGATCCT
TAAACAGGAATTCCTCCTAGAGGATTTAAAGATCCAGATTTTTTAGAATCATAGTAAAAC
GAATAATAATAAATGTAGTAAGATGAATCTTCGATATAGTTATAGCAACAAGTAGAATAA
AACCAAAGACAAAACCTTAATTAAAATATATTTTTAAGAAAAAATGTTTAAAAATACAAC
AGATACGACTTTTTCAATAACACATAATGA