Identifiers and Description

Gene Model Identifier

TTHERM_01222590

Standard Name

None

Aliases

PreTt16622 | 280.m00031

Description

Cell differentiation family, Rcd1-like containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04078 ) Cell differentiation family, Rcd1-like

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01222590

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09457.19.997093137033517e-262cell differentiation family, R
cd1-like containing protein (4
85 aa)
OxytrichaContig19959.0.g301.9994050701445255e-104Cell differentiation family, R
cd1-like
DictyBaseDDB_G02697789.000840820639671e-86DDB_G0269778 on chromosome: 1
position 3547267 to 3548768
SGDYNL288W1.0001478224244938e-84CAF40 Evolutionarily conserved
subunit of the CCR4-NOT compl
ex involved in controlling mRN
A initiation, elongation and d
egradation; binds Cdc39p
WormBaseWBGene000161399.999776257620412e-83locus:ntl-9 status:Partially
_confirmed UniProt:Q18224
protein_id:CCD65727.1
Stentor CoeruleusSteCoe_54612.7487850079102147e-43

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01222590(coding)
ATGTACCAATAGCCACCGCACTTTTCCTAAAATCCAAATCCCCAAGTGATTCCTCCTCAT
TCAATCTCTCCACAAATTATCTACAGCCATCCCCATTAGTAAATAATCTACCCTCAAGAA
ATTTATGGAATGTATCCTCATTTGGATTACTCTTAAATGTTAGCGGCTTCATAATCTCCT
CAACCTTAAGTGCCACAAGCTGCTTAATATTAAATGTCAAATGTTTAGCAACCTTATCCA
AGTGGACTCCTTCATATGCCTCAGCCTGTAGCTTAAATTCCTCCCTTGCATCAACCTATC
CCTTTCAGCAGTCCTTCTCCTTAAAATGTATTTGTGACATCTACTCCTCCTCCAATGTAA
CACATGTAGCCTTACATAATTCACGCTCAGATGAATTATCAACAAATCCCACCCCAACAG
AACTCTTCAATTCACTAAACTCCTCAGATAGATGACTAGCAGAATCAAAAGGAATTAGAC
TAAATTGTGTAGCACATTTTAAATTTAAAAGATCCTGAAAGAAAGGAAGAAGCTTTGTAG
GAACTTAGTAGAAAGAGAGAATCTTTCAATAACTTAGCTCCCCTTTTATGGCACTCGAAC
GGAACAATTGCTTTACTAATAGACGATATAGTTTCTGTCTATTCTTAGTTAGCTCCTAAT
GTCCTCACTTAAGCTGTTTCTACCCAGGTTTGTTCTGTCCTTGGTCTTCTTTAATGCTTA
GCTTTACATCCAGAAACGAAGCCCCACTTCATTAAAGCTCACATTCCTTTATTCTTATAC
CCTTTCCTCAACACTTCTGCAAAGCTAAAACCTTTTGAGAATTTGAGGGTAACTTCGTTG
GGTGTTATTGGAGCACTTGTGAAGGGTGATGACACTGAGGCAATAACATTTTTAATGCAA
ACTGAAATAATTCCTTTGTGCTTGCGTATTATGAAAAGAGGATAAGAATTATCAAGAACA
GTTGCTACATTTATTGTTTAGAAGATTTTAATTGATGACAATGGTTTGAATTATATTTGT
CAAACAGCAGAACGCTTCTTTGCTGTCTCCACAGTCCTTTAAAGCATGATTGAAGATTTA
GAATAAAATCAAAAAGATGACTAAAGACTCTTGAGACATATTATAAAATGCTATTAAAGA
CTTTCTGAAAACAACAGAGCAAACGAAGCACTGAAAAAGATAATTCCTCAAGGTTTCAAA
GACCCTAATTGGAGTCTAATTAAGGACGATTCTGTTAGAAAATTGCATCATTAACTAATG
CAAAACTTAGGCCTACACTCAGAAGACACAGCTTCATCTACTCCTTAAAGAGTTCCAAGT
GCCTAGTCAACTCAACCTCCTCCCTAAATGATGAACGCAGCAATGGGAGTACCTATGTAT
ACTCCTCAATAATAACAACAAGCTCAACCTCGCTACGCTAGTTTCTTGAACTAATATTGA


>TTHERM_01222590(protein)
MYQQPPHFSQNPNPQVIPPHSISPQIIYSHPHQQIIYPQEIYGMYPHLDYSQMLAASQSP
QPQVPQAAQYQMSNVQQPYPSGLLHMPQPVAQIPPLHQPIPFSSPSPQNVFVTSTPPPMQ
HMQPYIIHAQMNYQQIPPQQNSSIHQTPQIDDQQNQKELDQIVQHILNLKDPERKEEALQ
ELSRKRESFNNLAPLLWHSNGTIALLIDDIVSVYSQLAPNVLTQAVSTQVCSVLGLLQCL
ALHPETKPHFIKAHIPLFLYPFLNTSAKLKPFENLRVTSLGVIGALVKGDDTEAITFLMQ
TEIIPLCLRIMKRGQELSRTVATFIVQKILIDDNGLNYICQTAERFFAVSTVLQSMIEDL
EQNQKDDQRLLRHIIKCYQRLSENNRANEALKKIIPQGFKDPNWSLIKDDSVRKLHHQLM
QNLGLHSEDTASSTPQRVPSAQSTQPPPQMMNAAMGVPMYTPQQQQQAQPRYASFLNQY


>TTHERM_01222590(gene)
ATGTACCAATAGCCACCGCACTTTTCCTAAAATCCAAGTAATTTAGAGCAATAAGAGCAA
TATTATCCAATATTAAATAACATTTAAAAATGTTGTTCTAACTAATCTGGAATTATTCAA
AATATAAACAAACAATTTTGAAATTAAAAAATAGATCCCCAAGTGATTCCTCCTCATTCA
ATCTCTCCACAAATTATCTACAGCCATCCCCATTAGTAAATAATCTACCCTCAAGGTAAG
AAACTTTAAAAATTAAATAATGTTTATTATAATTATTATTTTATTTAATTTTAAAAGAAA
TTTATGGAATGTATCCTCATTTGGATTACTCTTAAATGTTAGCGGCTTCATAATCTCCTC
AACCTTAAGTGCCACAAGCTGCTTAATATGTATTTTATTCAAAGGATTTCGCAATTCTTT
TTTTATTGACTGATTAATAATATAAAAATAATAGTAAATGTCAAATGTTTAGCAACCTTA
TCCAAGTGGACTCCTTCATATGCCTCAGCCTGTAGCTTAAATTCCTCCCTTGCATCAACC
TATCCCTTTCAGCAGTCCTTCTCCTTAAAATGTATTTGTGACATCTACTCCTCCTCCAAT
GTAACACATGTAGCCTTACATAATTCACGCTCAGATGAATTATCAACAAATCCCACCCCA
AGTAAATATTAAATATTTCTTTTTATCAATAATCAATAAAATATTGAATTAGAATTAATT
TTTGTATTAAAAACCTATTCAAAATATAAAGATTATTAATTTATATTTTTCTTATTAATA
ACAATGTATTTTATAATCAAAATTCTTAGCAGAACTCTTCAATTCACTAAACTCCTCAGA
TAGATGACTAGCAGAATCAAAAGGAATTAGACTAAATTGTGTAGCACATTTTAAATTTAA
AAGATCCTGAAAGAAAGGAAGAAGCTTTGTAGGAACTTAGTAGAAAGAGAGAATCTTTCA
ATAACTTAGCTCCCCTTTTATGGCACTCGAACGGAACAATTGCTTTACTAATAGACGATA
TAGTTTCTGTCTATTCTTAGTTAGCTCCTAATGTCCTCACTTAAGCTGTTTCTACCCAGG
TTTGTTCTGTCCTTGGTCTTCTTTAATGCTTAGCTTTACATCCAGAAACGAAGCCCCACT
TCATTAAAGGTAATAATTTCACCAACAATAAAATCTCCTTAAATTTCCTAATGAAATTAT
TTTAAATTCATCTCAAAGCAAATTTTTTGTTTAAAATCTTTGCTTCTTTCTAGCTAATTT
ATTTCTTAATTTTCAATATTAAATTAAAATCTAAATGAAATTTATTTTTAATATTGAATT
TTTTAATAAAAGCTCACATTCCTTTATTCTTATACCCTTTCCTCAACACTTCTGCAAAGC
TAAAACCTTTTGAGAATTTGAGGGTAACTTCGTTGGGTGTTATTGGAGCACTTGTGAAGG
GTGATGACACTGAGGCAATAACATTTTTAATGCAAACTGAAATAATTCCTTTGTGCTTGC
GTATTATGAAAAGAGGATAAGAATTATCAAGAACAGTTGCTACATTTATTGTTTAGAAGA
TTTTAATTGATGACAATGGTTTGAATTATATTTGTCAAACAGCAGAACGCTTCTTTGCTG
TAAATAATTCATTAAATAAAAAAATGCTAAAATCTATTAATTTTTAATTAGGTCTCCACA
GTCCTTTAAAGCATGATTGAAGATTTAGAATAAAATCAAAAAGATGACTAAAGACTCTTG
AGACATATTATAAAATGCTATTAAAGACTTTCTGAAAACAACAGGTTGAAATTTAACAAT
ATTTATTAGCATTTAAATTAATTTCTTTTTTTTTAAATTAGAGCAAACGAAGCACTGAAA
AAGATAATTCCTCAAGGTTTCAAAGACCCTAATTGGAGTCTAATTAAGGACGATTCTGTT
AGAAAATTGCATCATTAACTAATGCAAAACTTAGGCCTACACTCAGAAGACACAGCTTCA
TCTACTCCTTAAAGAGTTCCAAGTGCCTAGTCAACTCAACCTCCTCCCTAAATGATGAAC
GCAGCAATGGGAGTACCTATGTATACTCCTCAATAATAACAACAAGCTCAACCTCGCTAC
GCTAGTTTCTTGAACTAATATTGA