Identifiers and Description

Gene Model Identifier

TTHERM_01217200

Standard Name

None

Aliases

PreTt28280 | 278.m00025 | RAE1

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00400 ) WD domain, G-beta repeat

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01217200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14047.19.997093137033517e-262hypothetical protein (372 aa)
WormBaseWBGene000038031.9997255150861791e-53locus:rae-1 Nucleoporin-17
status:Partially_confirmed
UniProt:Q93454 protein_id:CA
B02280.1
SGDYER107C5.998439611888618e-47GLE2 Component of the Nup82 su
bcomplex of the nuclear pore c
omplex; required for polyadeny
lated RNA export but not for p
rotein import; homologous to S
. pombe Rae1p
DictyBaseDDB_G02838352.9986404383886433e-43rae1 on chromosome: 4 position
1191439 to 1192760
OxytrichaContig8029.0.g986.002270911168926e-31WD domain, G-beta repeat
Stentor CoeruleusSteCoe_78951.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_01217200(coding)
ATGAACTAGCCTTAGCAATAATAATAGGATGCCTCTTTGCAAGATATTCAAATTAACAAT
CCCTAGCACTTGCCTTAAGACACTGTATCTGACATTCAATTCAATCCTTAAAATCCCTAA
ATGTTTGCTTGTTCGACTTGGGATGGCAAGATTCACATTTATTAAATCGCAGTCTAACAA
AATTTCAACTAAATAGTTGGATAATTCTAATAAGTTAGTTAGATGCAATACAACGAGCCT
ATTACCTGCATTGCATGGAGAGGTGATGGATAAGCTATCTATGCAGGTTGTGGTGATAAT
TCAGTTGTACTCTTTAATTTAAGTAATGGATAAAGTGCTAAAATAGGACAACATTAAGCA
GGTATTAGATCTATTTTCTACGTCTAATAATTAAATGGAGCTGTAATTACTTGTTCTTTT
GACACTACTGTTTGCTTCTGGTCAGAATAAAATCCTAATAATCCTTTGGCTAAAATATAA
TTGAAGGGAAAAATTTTCGCTGCTGATTGCTTATTCCCAATTTTGGCATTAGGCTTGTAG
GGCGAAGTGATTACTTTTATCAATTTGTAATCAAATTTCTAAAATCTTAGTCCTCATTAA
ATTAATTACATAGATTCTCCTCTTGGAAAGGGAAGTTAAATAAATAGCATTAAAATTATG
TGCAAAGGTAATGGTTTTGGTCTTGGCTCTATTGATGGAAGAGCAAATCTTGGCAAACTT
ACTCCCTAAAACTAAAATAATGTTGCAGGATATAAGATCGATAACATTATGACCTTCAAA
TGTCATAAAAATGAAGAAAAGCAAAACAACGTTGTAAACCAAATATTATATCCAGTAAAC
TCTATTTGCTTTAACCCTCGTCAAGATTAATTTTTATTGACCTGTGGCTCAGATGGCAAT
ATGTATTTCTGGGATTTCGAGCACAAAAATAAGATTAAATCCTTTGCCTTCAACAAACAA
CCTATTAGTGCTTGCAACGTCTCTTCAACCGGACAATTCCTTGCATATTCTCTTGGTTAT
GATTGGCATATGGGATACGAACACTCTAACTCATTCGAAAAGCCTAAAATCTGTGTTCAC
ATTATAAATGACGATGAATTAAGATTTAGGAAAAATTGA


>TTHERM_01217200(protein)
MNQPQQQQQDASLQDIQINNPQHLPQDTVSDIQFNPQNPQMFACSTWDGKIHIYQIAVQQ
NFNQIVGQFQQVSQMQYNEPITCIAWRGDGQAIYAGCGDNSVVLFNLSNGQSAKIGQHQA
GIRSIFYVQQLNGAVITCSFDTTVCFWSEQNPNNPLAKIQLKGKIFAADCLFPILALGLQ
GEVITFINLQSNFQNLSPHQINYIDSPLGKGSQINSIKIMCKGNGFGLGSIDGRANLGKL
TPQNQNNVAGYKIDNIMTFKCHKNEEKQNNVVNQILYPVNSICFNPRQDQFLLTCGSDGN
MYFWDFEHKNKIKSFAFNKQPISACNVSSTGQFLAYSLGYDWHMGYEHSNSFEKPKICVH
IINDDELRFRKN


>TTHERM_01217200(gene)
ATGAACTAGCCTTAGCAATAATAATAGGATGCCTCTTTGCAAGATATTCAAATTAACAAT
CCCTAGCACTTGCCTTAAGACACTGTATCTGACATTCAATTCAATCCTTAAAATCCCTAA
ATGTTTGCTTGTTCGACTTGGGATGGCAAGATTCACATTTATTAAATCGCAGTCTAACAA
AATTTCAACTAAATAGTTGGATAATTCTAATAAGTTAGTTAGATGCAATACAACGAGCCT
ATTACCTGCATTGCATGGAGAGGTGATGGATAAGCTATCTATGCAGGTTGTGGTGATAAT
TCAGTTGTACTCTTTAATTTAAGTAATGGATAAAGTGCTAAAATAGGTAATACATTAACT
TTATTTTTTTGAATAATTATGATCAAATCTTTAATCCATCAAGCCTAACTCTATTAAAAA
ATGAAAAACTAAATTAAAGATAATTCAATCATATTAAAATTGCAATATAGATTATTTAAT
TTAGATAAAGAACATCGCTAATTTTAGTGAGTTTTCTTTCTTTATAATCTAACTGATGAA
ATAAAATTAATATCATAACTAAGCATATTACACCTCTTCAACTCAGAATAATTAATACAA
TAAATGAAGAAAAATAAAAGTAAAATAAATGCGTTAAAATGAAATTTGAGCTTTTACTTC
ATATGAAAGATTAATAAGATTGATTTATCACAGAATAAAGTTAATGAAAAAAAACAAAAA
ACAAATTAAGGTTGTTAAAGTAAGTTTAAATGGTGAAAAATGAGATAGAGATATTCAATT
AATAAATATTTTATTTTAGCTTTAATGTGTTAATTAATATTCAATTTTATATAAAATAAT
ATAGGACAACATTAAGCAGGTATTAGATCTATTTTCTACGTCTAATAATTAAATGGAGCT
GTAATTACTTGTTCTTTTGACACTACTGTTTGCTTCTGGTCAGAATAAAATCCTAATAAT
CCTTTGGCTAAAATATAATTGAAGGGAAAAATTTTCGCTGCTGATTGCTTATTCCCAATT
TTGGCATTAGGCTTGTAGGGCGAAGTGATTACTTTTATCAATTTGTAATCAAATTTCTAA
AATCTTAGTCCTCATTAAATTAATTACATAGATTCTCCTCTTGGAAAGGGAAGTTAAATA
AATAGCATTAAAATTATGTGCAAAGGTAATGGTTTTGGTCTTGGCTCTATTGATGGAAGA
GCAAATCTTGGCAAACTTACTCCCTAAAACTAAAATAATGTTGCAGGATATAAGATCGAT
AACATTATGACCTTCAAATGTCATAAAAATGAAGAAAAGCAAAACAACGTTGTAAACCAA
ATATTATATCCAGTAAACTCTATTTGCTTTAACCCTCGTCAAGATTAATTTTTATTGACC
TGTGGCTCAGATGGCAATATGTATTTCTGGGATTTCGAGCACAAAAATAAGATTAAATCC
TTTGCCTTCAACAAACAACCTATTAGTGCTTGCAACGTCTCTTCAACCGGACAATTCCTT
GCATATTCTCTTGGTTATGATTGGCATATGGGATACGAACACTCTAACTCATTCGAAAAG
CCTAAAATCTGTGTTCACATTATAAATGACGATGAATTAAGATTTAGGAAAAATTGA