Identifiers and Description

Gene Model Identifier

TTHERM_01207690

Standard Name

None

Aliases

PreTt09122 | 274.m00039

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03991 ) Copper binding octapeptide repeat
  • ( PF06777 ) Protein of unknown function (DUF1227)
  • ( PF08385 ) Dynein heavy chain, N-terminal region

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20948.19.997093137033517e-262phosphoenolpyruvate carboxylas
e (931 aa)
DictyBaseDDB_G02877233.000969471571755e-58DDB_G0287723 on chromosome: 5
position 601565 to 604462

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01207690(coding)
ATGATCAACATAAAAAGAATTCTAGGAAAAAGGACTGATTTACTTCATTTCATTAATGGA
AGTAGCTAACAGTCTCTTCAATAATATTAAAAGGCATCACAAGGCTTGTAGTTCCTTTCT
GGATAGAGCAAATAGCCTAAAATTCATAACTAGAATTTTTACTAGTTTTCTGCAATGAAG
CGTACATTCGATCTATTGAATGATTAGAAGAAGCTCAAAAGTGTCACCAACAAAGAAATT
CTTCTTGCTAACTTTGAGTCAAGAGTCCAACTAAGATATTAGCTTTTAAACTCTCTCTTT
TAGACTCTTCCCGTAGATTAAATAAACGAAACTAGTATGTTGATACCAATTTTAACCCAT
GCTTGTTAGAAAGGATTAGAATCAGGATTAAGCCCAGAAGAAGTTATTGATAAATTTTTC
AAAGAGTATGATTAAAACTAAATCTATAACACTGAGCAAAAGAAAATAGACTTCCTTTTC
CGCGTCGTTTAGTTTGTTGAAAGATAAGTTGTGCTGGTTGATGCTCTTGAAGATGCTAAT
TATTCATAAATTAACGATCTACATGGTCCTGAATCATTAGGTAATTTAATTGAAAGAATA
AGAAGACACAATTTGGATGATGAACTCTTGAAATAGCTTTCTAGATTTGCTGTTAGAGTT
GTACTTACTGCTCACCCTACTCAGTTTTATCCTAAACAAGTTCTTTCTATCATTAATGAT
TTAAATGAAGCTATTTAATCTAATGATATAACTTAAATCTAATATCTACTTTGGTAACTA
GCAAAAACTCCTTTCTTCTAAAGAGAAAAACCTACTCCATTAGACGAGGCATAGTTCTTA
ATTTAGTATCTAGAAAATGTATTTTATGATGCAGTTGGTACTCTCCAAGATAGGCTCAGA
AAGGTTTTAGGTTCTAAATTCGATAAACAAAAAGAGTTTCATAAATTTTACACTCTAGGT
TTCTGGCCAGGTGGAGACAGAGATGGAAATCCTTTTGTTAGAGTTGAAACAACTAAAAAG
GTAGCAAAATTACTTAGAACTTCCATCCTGAAATGTTACATCAGAGATGTACGCTAAGTA
AAAAAGAGATTGAGTTTCAAAGGAATTTATGAGCTATTAGAAGAAATAGAAAACGACTTT
GGTTCTAACTTCTCATATAAACCTTCAGTAAGCCTTGAATAATTGTATGAAAAACTTGAC
TTTATTAGATAAAAAATTATCACTGACCACAATGGATTATTTTTACCCATCTTTGAGAAT
TTCTAAAGAAAAGTTCATACATTCGGATACCACTTTGCTTCGATTGATATTCGTTAAGAT
TCTAGAGTTTTAGATAAGACCTTCAAAGCATTACAAGAAAAAGTTCCTTATATGCTCCCA
TATAACTTTGAAGAACTCCCTGTCTAATAGAAATTAGATTTATTATTGAGTCTTAAGCCT
CTCAATACAGTACCCTAACTTGATGATGAAGTGTTGAATGATACTCTCTAAACTTTTAAT
GCCATGAGGGAAATATAAGAAGAAAATGGAGAATTTGGTTCCTACCGCTTTATCATTTCC
AACTGTAGAGGACCTCTTGATGTTGCTAAGGTTTATGCTATGAGTTAGTTAACTGGAGGA
TGGTCTGGTAATTCTAAAATCGATGTTGTACCTCTTTTTGAAACTATCGATGATCTTAAG
TCTGCAGACAAATCTATGAAGGAACTATTTTCTAACGGTATATATCAAAAACACTTAAAG
TTTAGAAAAATGAGGTAAACTATCATGTGTGGTTTCTCTGATGGTACTAAAGATGGTGGC
TATCTTGGAGCTAATTGGGGAATTTACTAAGCTAAAGAAAATCTGAGTAAAATATCTAGG
GATTATGGTGTAGAAGCTATCTTTTTCGATGGTAGAGGTGGTCCACCTGCTCGTGGTGGT
GGTAACAAGCACTTGTATTATGCTTCTCAAGGTCCTACTATAGAAAATCATGAAATCCAA
ATTACTATCCAAGGTTAAACTATCAGCTCTAACTTCGGTGTTACAGATAGTTGTCTTCAT
AATTTAGAACTCTTAATGTCAGCAGGTTTGTAAAATAATGTCCTTGAAGACCCTAAAAGA
GTATTGACACAATCTTAACGCGATCTTTTAAATGAACTTTCCGAGGTATCTTTAAAGTCG
TACCTTGAATTTAAGAATCATCCTAAATTTATGCCTTATCTGTTAGAAAAATCTCCATTA
AAATATTATGGTGAAGCTAATATTGGTTCCAGACCAGCTAAAAGAAGTGCTGGAGGAGAA
ATGAAGTTTGAAGATTTAAGAGCTATACCATTTGTAGGAGCTTGGTCACAACTCAAACAA
AACGTTCCAGGGTTTTATGGCTTGGGAACAGCTCTTAAAAAGCTTGAAGCAGAAGGAAGA
CTGAACGAAGCTGCAGATTTATATAAAGATAGTTTATTCTTCAAAGCATTAGTTTAAAAC
TCTATGATGTCAATGTGTAAAACTTACTTCCCCTTAACTCACTACATGTTGAAAGATAAA
TAATATAGTGAATTTTGGAATTAAATTTATAATGAATTCTAAGAAACTGAAAGATTGTTA
CTTCTTATCACTGAACAAAAGCAATTACTTGACAATGAACCTGTTATAAAATAAAGTATC
AAATTAAGAGAATAAATTGTTCTCCCTCTACTCACTATTTAGTAATTTGCGCTTCAAAGA
ATTAATAAAGATCATCAAGAAGATCTTCATAAATCATATCAAAATCTTATCATCCGTTCT
CTCTTCGGTAGTATAAACGCTACAAGAAACGCTGCTTGA


>TTHERM_01207690(protein)
MINIKRILGKRTDLLHFINGSSQQSLQQYQKASQGLQFLSGQSKQPKIHNQNFYQFSAMK
RTFDLLNDQKKLKSVTNKEILLANFESRVQLRYQLLNSLFQTLPVDQINETSMLIPILTH
ACQKGLESGLSPEEVIDKFFKEYDQNQIYNTEQKKIDFLFRVVQFVERQVVLVDALEDAN
YSQINDLHGPESLGNLIERIRRHNLDDELLKQLSRFAVRVVLTAHPTQFYPKQVLSIIND
LNEAIQSNDITQIQYLLWQLAKTPFFQREKPTPLDEAQFLIQYLENVFYDAVGTLQDRLR
KVLGSKFDKQKEFHKFYTLGFWPGGDRDGNPFVRVETTKKVAKLLRTSILKCYIRDVRQV
KKRLSFKGIYELLEEIENDFGSNFSYKPSVSLEQLYEKLDFIRQKIITDHNGLFLPIFEN
FQRKVHTFGYHFASIDIRQDSRVLDKTFKALQEKVPYMLPYNFEELPVQQKLDLLLSLKP
LNTVPQLDDEVLNDTLQTFNAMREIQEENGEFGSYRFIISNCRGPLDVAKVYAMSQLTGG
WSGNSKIDVVPLFETIDDLKSADKSMKELFSNGIYQKHLKFRKMRQTIMCGFSDGTKDGG
YLGANWGIYQAKENLSKISRDYGVEAIFFDGRGGPPARGGGNKHLYYASQGPTIENHEIQ
ITIQGQTISSNFGVTDSCLHNLELLMSAGLQNNVLEDPKRVLTQSQRDLLNELSEVSLKS
YLEFKNHPKFMPYLLEKSPLKYYGEANIGSRPAKRSAGGEMKFEDLRAIPFVGAWSQLKQ
NVPGFYGLGTALKKLEAEGRLNEAADLYKDSLFFKALVQNSMMSMCKTYFPLTHYMLKDK
QYSEFWNQIYNEFQETERLLLLITEQKQLLDNEPVIKQSIKLREQIVLPLLTIQQFALQR
INKDHQEDLHKSYQNLIIRSLFGSINATRNAA


>TTHERM_01207690(gene)
ATGATCAACATAAAAAGAATTCTAGGAAAAAGGACTGATTTACTTCATTTCATTAATGGA
AGTAGCTAACAGTCTCTTCAATAATATTAAAAGGCATCACAAGGCTTGTAGTTCCTTTCT
GGATAGAGCAAATAGCCTAAAATTCATAACTAGAATTTTTACTAGTTTTCTGCAATGAAG
CGTACATTCGATCTATTGAATGATTAGAAGAAGCTCAAAAGTGTCACCAACAAAGAAATT
CTTCTTGCTAACTTTGAGTCAAGAGTCCAACTAAGATATTAGCTTTTAAACTCTCTCTTT
TAGACTCTTCCCGTAGATTAAATAAACGAAACTAGTATGTTGATACCAATTTTAACCCAT
GCTTGTTAGAAAGGATTAGAATCAGGATTAAGCCCAGAAGAAGTTATTGATAAATTTTTC
AAAGAGTATGATTAAAACTAAATCTATAACACTGAGCAAAAGAAAATAGACTTCCTTTTC
CGCGTCGTTTAGTTTGTTGAAAGATAAGTTGTGCTGGTTGATGCTCTTGAAGATGCTAAT
TATTCATAAATTAACGATCTACATGGTCCTGAATCATTAGGTAATTTAATTGAAAGAATA
AGAAGACACAATTTGGATGATGAACTCTTGAAATAGCTTTCTAGATTTGCTGTTAGAGTT
GTACTTACTGCTCACCCTACTCAGTTTTATCCTAAACAAGTTCTTTCTATCATTAATGAT
TTAAATGAAGCTATTTAATCTAATGATATAACTTAAATCTAATATCTACTTTGGTAACTA
GGTAAAATTTTATTTCTCCTAAATATTAGTTTAATTAATCAATTAATACGTTTTTAACTT
ATTTTAGCAAAAACTCCTTTCTTCTAAAGAGAAAAACCTACTCCATTAGACGAGGCATAG
TTCTTAATTTAGTATCTAGAAAATGTATTTTATGATGCAGTTGGTACTCTCCAAGATAGG
CTCAGAAAGGTTTTAGGTTCTAAATTCGATAAACAAAAAGAGTTTCATAAATTTTACACT
CTAGGTTTCTGGCCAGGTGGAGACAGAGATGGAAATCCTTTTGTTAGAGTAGATTATTAA
ATTATTTTATAAAAATGAAAAAAATAAATAATAAAAAAAAAGGTTGAAACAACTAAAAAG
GTAGCAAAATTACTTAGAACTTCCATCCTGAAATGTTACATCAGAGATGTACGCTAAGTA
AAAAAGAGGTAATTAATTTATTTTAATTAAAAAATATAAAAAAGCTGAACTACTGAATTT
AGAAAAGAAAAAATTTATGGCAAAAATTTATTCTTGTAGATTTTATTTTGAATAAAAAGA
AGGGATTAAAAGCTATAGAAAATTTTTAATGCTCAAACTTCGCCAAATATTTAATTAAAA
TTTATAAAAAATTGTAAAATTACCAAAATAGACAAATTTAATAAATGCTAATTAAAATAG
ATTGAGTTTCAAAGGAATTTATGAGCTATTAGAAGAAATAGAAAACGACTTTGGTTCTAA
CTTCTCATATAAACCTTCAGTAAGCCTTGAATAATTGTATGAAAAACTTGACTTTATTAG
ATAAAAAATTATCACTGACCACAATGGATTATTTTTACCCATCTTTGAGAATTTCTAAAG
AAAAGTTCATACATTCGGATACCACTTTGCTTCGATTGATATTCGTTAAGATTCTAGAGT
TTTAGATAAGACCTTCAAAGCATTACAAGAAAAAGTTCCTTATATGCTCCCATATAACTT
TGAAGAACTCCCTGTCTAATAGAAATTAGATTTATTATTGAGTCTTAAGCCTCTCAATAC
AGTACCCTAACTTGATGATGAAGTGTTGAATGATACTCTCTAAACTTTTAATGCCATGAG
GGAAATATAAGAAGAAAATGGAGAATTTGGTTCCTACCGCTTTATCATTTCCAACTGTAG
AGGACCTCTTGATGTTGCTAAGGTTTATGCTATGAGTTAGTTAACTGGAGGATGGTCTGG
TAATTCTAAAATCGATGTTGTACCTCTTTTTGAAACTATCGATGATCTTAAGTCTGCAGA
CAAATCTATGAAGGAACTATTTTCTAACGGTATATATCAAAAACACTTAAAGTTTAGAAA
AATGAGGTAAACTATCATGTGTGGTTTCTCTGATGGTACTAAAGATGGTGGCTATCTTGG
AGCTAATTGGGGAATTTACTAAGCTAAAGAAAATCTGAGTAAAATATCTAGGGATTATGG
TGTAGAAGCTATCTTTTTCGATGGTAGAGGTGGTCCACCTGCTCGTGGTGGTGGTAACAA
GCACTTGTATTATGCTTCTCAAGGTCCTACTATAGGTATGAAATATTTTTAATTTTTTTC
AATTATTTATTAAATTTTATATTTTAAATAGAAAATCATGAAATCCAAATTACTATCCAA
GGTTAAACTATCAGCTCTAACTTCGGTGTTACAGATAGTTGTCTTCATAATTTAGAACTC
TTAATGTCAGCAGGTTTGTAAAATAATGTCCTTGAAGACCCTAAAAGAGTATTGACACAA
TCTTAACGCGATCTTTTAAATGAACTTTCCGAGGTATCTTTAAAGTCGTACCTTGAATTT
AAGAATCATCCTAAATTTATGCCTTATCTGTTAGAAAAATCTCCATTAAAATATTATGGT
GAAGCTAATATTGGTTCCAGACCAGCTAAAAGAAGTGCTGGAGGAGAAATGAAGTTTGAA
GATTTAAGAGCTATACCATTTGTAGGAGCTTGGTCACAACTCAAACAAAACGTTCCAGGG
TTTTATGGTAATTTAAAAATTTATAATAAATAAAGCAAATTTCTTACAAATTTATCTTTT
CTTAGGCTTGGGAACAGCTCTTAAAAAGCTTGAAGCAGAAGGAAGACTGAACGAAGCTGC
AGATTTATATAAAGATAGTTTATTCTTCAAAGCATTAGTTTAAAACTCTATGATGTCAAT
GTGTAAAACTTACTTCCCCTTAACTCACTACATGTTGAAAGATAAATAATATAGTGAATT
TTGGAATTAAATTTATAATGAATTCTAAGAAACTGAAAGATTGTTACTTCTTATCACTGA
ACAAAAGCAATTACTTGACAATGAACCTGTTATAAAATAAAGTATCAAATTAAGAGAATA
AATTGTTCTCCCTCTACTCACTATTTAGTAATTTGCGCTTCAAAGAATTAATAAAGATCA
TCAAGAAGATCTTCATAAATCATATCAAAATCTTATCATCCGTTCTCTCTTCGGTAGTAT
AAACGCTACAAGAAACGCTGCTTGA