Identifiers and Description

Gene Model Identifier

TTHERM_01194660

Standard Name

None

Aliases

PreTt07503 | 270.m00029

Description

translation elongation factor G

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF08608 ) Wyosine base formation
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( PF00679 ) Elongation factor G C-terminus
  • ( PF03764 ) Elongation factor G, domain IV
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00503 ) peptide chain release factor 3
  • ( TIGR00484 ) translation elongation factor G
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( TIGR00487 ) translation initiation factor IF-2
  • ( TIGR00490 ) translation elongation factor aEF-2
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02086 ) 3-isopropylmalate dehydratase, large subunit
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.6%

TetraMine Data

TTHERM_01194660

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_194630
WormBaseWBGene000092469.997093137033517e-262locus:gfm-1 Elongation facto
r G, mitochondrial status:Co
nfirmed UniProt:Q9XV52 pro
tein_id:CAB04216.1
Tetrahymena borealisEI9_21008.19.997093137033517e-262translation elongation factor
G (744 aa)
DictyBaseDDB_G02704829.997093137033517e-262gfm1 on chromosome: 1 position
2561561 to 2563899
OxytrichaContig645.1.g79.997093137033517e-262Elongation factor Tu GTP bindi
ng domain
SGDYLR069C9.997093137033517e-262MEF1 Mitochondrial elongation
factor involved in translation
al elongation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01194660(coding)
ATGTTTGGTAGATTATTTGCCCATCAATCTAAGTTGATTGGAGCTGCTTAAAAATACTAG
CACAGCAATATTTAATTTGCTAACAAGTTTAATGCTCTCTCCTTCAACCCCTACTATAAT
TTCTGCTTAAGAAATATTGGTATTTCAGCACATATCGATTCTGGTAAAACTACTTTTACT
GAAAGAGTTCTTTTCTACGCTGGTAAAATTAATGCTATCCACGATGTCAAGGGTACCGAT
GGTGTAGGTGCTACCATGGATTTCATGGATCTTGAAAGAGAAAAGGGTATTACTATTTAA
AGTGCTGCTACACATTTAAAATGGGGCAATACCAGTATTAACGTTATTGATACTCCTGGT
CACGTAGATTTTACTATTGAAGTAGAAAGAGCTCTTAGAGTGCTCGATGGTGGTGTCTTA
CTTCTTTGCGGTGTTGCAGGTGTTCAACCTTAAACACTCACAGTTTTTAAGCAAATGGTT
AGATATTAAGTCCCTCGTATCATTTTCATTAACAAGCTTGACAGAATGGGTGCTAATCCT
TGGGCTGCTATTGATAGTGTCAGAAAGAGACTTAACATCCACGCTGCTGCTGTCTAAATT
CCTATTGGTATTGATCAAAGTTTAAAAGGTTTAGTTGATATTGTTGAAATGAAGGCTATT
ATTTTTGAAGGTGAAAGTGGTGAAATTTTGAACGTTTAAGATGTTCCTGCTAATTTGATA
GAACTTGCTAAAGAAAAAAGACACGAACTTATTGAAGTCTTAGCTGAAATCGATCATCAA
ATCGAAGAAAAGTATCTCGCTGAAGAAGAACTCACTGCTGAAGAAATCAAGGCTGCTATT
CGTAGATAGACTATTGCCTTGAAATTCTCCCCTGTTTTCATGGGATCTGCATTCAAGAAC
AAAGGTGTTTAATTAGCCTTAGATGGTGTTAGAGATTATTTACCTAAGCCTGATGAAAGA
AAGAACGTTGGATTTTTATAAAAAGAAGATACTCAAGCTGAAGAAAAGATTGAATTTATT
CCTGATCCTAAACTTCCTTTTGTTGGTTATGCCTTCAAGCTTGAAGAAAGCAAATTCGGA
TAATTGACTTACGTTAGAGTTTACTAAGGTAAGCTTAAGAGAGGTGATAATGTTTATAAT
ACTACTGTCAAAAAGAGAATGAAAATCTCCAGAATGATTAAAATGCATGCCAATTAGATG
GAAGAAATTAATGAAGCTGGTCCTGGTGAAATTTTCGCTATTTTTGGTGTTGAATGCGCT
ACTGGTGATACCCTTTGCGAAGGTGATATGTCTTACACAGCTAGATGCAGTAGTATGCAC
GTCCCAGCTCCAGTCGTTAACTTGAGTATTAAGCCCAAGGATAACAAGTCAAGTGCTAAG
TTTAATAAAGCCTTGAAGAAGTTCTCTAGAGAAGATCCCACCTTCAGAGTTAGCATTGAT
AAAGAAAGTGAAGAAATTGTTATTTCTGGTATGGGTGAATTGCATTTACAAATCTATGCT
GAAAGAATGAGAAGAGAATTCGACGTTGATGTCATTCTTGGTAATCCCACTGTCAACTAC
AGAGAAACTATCACTTAAAAGGCTCACTTTGATTATCTCCATAAGAAACAATCTGGTGGT
GCTGGTCAATTTGCCAGAGTTATCGGTTTTGTTGAACCAATGGTCAATCCTGAAGATCCC
CAAGATTTTAGCTGCTAATTCGTTAACAAGGTTATTGGTACCAATGTTCCTAATGAATAC
GTAACTGCTTGTGAAAAATCTTTCTACGATGTTATTGATAAGGGTCCTCAAACTGGTTAT
CCTGTCGTCAACATGAAGTTTGTCTTAGAAGATGGTCAAACTCACGTTGTCGATTCTTCT
TCTAATGCTTTCATGATTGCTACTAAATATGCTTTCAACAAGGCCTTCAATGATGCTGGT
CCTGTTATTCTTGAACCTTTTATGAATGTTGAAGTTACTTGCGCCGCTGCTGAATATCAA
TCTGTTATGGCTGCCATTTCTAAAAGAAGAGGTTTAATTACTAACACTGAATCAAGAGGT
GATATTTTCATTCTTAATGCTGACTGTCCTCTTTCTTAAATGTTCGGTTTTGCTACTGAA
TTGAGAGGTTTAACATCAGGTCAAGGTGAATTCTCTATGGAATACAAGAGTCATGAACCT
ATTGATCCATCCCAAGCTGAAGAAGTCAAGAAACAATATCAAATTAGAAGAAAGGATAAA
GGTCAAGATTGA


>TTHERM_01194660(protein)
MFGRLFAHQSKLIGAAQKYQHSNIQFANKFNALSFNPYYNFCLRNIGISAHIDSGKTTFT
ERVLFYAGKINAIHDVKGTDGVGATMDFMDLEREKGITIQSAATHLKWGNTSINVIDTPG
HVDFTIEVERALRVLDGGVLLLCGVAGVQPQTLTVFKQMVRYQVPRIIFINKLDRMGANP
WAAIDSVRKRLNIHAAAVQIPIGIDQSLKGLVDIVEMKAIIFEGESGEILNVQDVPANLI
ELAKEKRHELIEVLAEIDHQIEEKYLAEEELTAEEIKAAIRRQTIALKFSPVFMGSAFKN
KGVQLALDGVRDYLPKPDERKNVGFLQKEDTQAEEKIEFIPDPKLPFVGYAFKLEESKFG
QLTYVRVYQGKLKRGDNVYNTTVKKRMKISRMIKMHANQMEEINEAGPGEIFAIFGVECA
TGDTLCEGDMSYTARCSSMHVPAPVVNLSIKPKDNKSSAKFNKALKKFSREDPTFRVSID
KESEEIVISGMGELHLQIYAERMRREFDVDVILGNPTVNYRETITQKAHFDYLHKKQSGG
AGQFARVIGFVEPMVNPEDPQDFSCQFVNKVIGTNVPNEYVTACEKSFYDVIDKGPQTGY
PVVNMKFVLEDGQTHVVDSSSNAFMIATKYAFNKAFNDAGPVILEPFMNVEVTCAAAEYQ
SVMAAISKRRGLITNTESRGDIFILNADCPLSQMFGFATELRGLTSGQGEFSMEYKSHEP
IDPSQAEEVKKQYQIRRKDKGQD


>TTHERM_01194660(gene)
ATGTTTGGTAGATTATTTGCCCATCAATCTAAGTTGATTGGAGCTGCTTAAAAATACTAG
CACAGCAATATTTAATTTGCTAACAAGTTTAATGCTCTCTCCTTCAACCCCTACTATAAT
TTCTGCTTAAGAAATATTGGTATTTCAGCACATATCGATTCTGGTAAAACTACTTTTACT
GAAAGAGTTCTTTTCTACGCTGGTAAAATTAATGCTATCCACGATGTCAAGGGTACCGAT
GGTGTAGGTGCTACCATGGATTTCATGGATCTTGAAAGAGAAAAGGTAAAAATTAAAATT
TCTTTTGGCAAAATGATTGCTAGAATGATTACTCCACTCCATAAAATATATTTAGTTTAA
CAAAAATATATGAATTAACATGAAAATATTTTAATTGAAAACTTAAGTTATTTAAATTAA
TATCATTCTAAGCTATGCTTTTATTTGTTTTCCTTAAAATTTAAATAAATTTATTATGAT
AATATTTTAAAATATGTTTGTAAAAAAAAGGGTATTACTATTTAAAGTGCTGCTACACAT
TTAAAATGGGGCAATACCAGTATTAACGTTATTGATACTCCTGGTCACGTAGATTTTACT
ATTGAAGTAGAAAGAGCTCTTAGAGTGCTCGATGGTGGTGTCTTACTTCTTTGCGGTGTT
GCAGGTGTTCAACCTTAAACACTCACAGTTTTTAAGCAAATGGTTAGATATTAAGTCCCT
CGTATCATTTTCATTAACAAGCTTGACAGAATGGGTGCTAATCCTTGGGCTGCTATTGAT
AGTGTCAGAAAGAGACTTAACATCCACGCTGCTGCTGTCTAAATTCCTATTGGTATTGAT
CAAAGTTTAAAAGGTTTAGTTGATATTGTTGAAATGAAGGCTATTATTTTTGAAGGTGAA
AGTGGTGAAATTTTGAACGTTTAAGATGTTCCTGCTAATTTGATAGAACTTGCTAAAGAA
AAAAGACACGAACTTATTGAAGTCTTAGCTGAAATCGATCATCAAATCGAAGAAAAGTAT
CTCGCTGAAGAAGAACTCACTGCTGAAGAAATCAAGGCTGCTATTCGTAGATAGACTATT
GCCTTGAAATTCTCCCCTGTTTTCATGGGATCTGCATTCAAGAACAAAGTAATTATTAAA
AAATATTTTACGAAATTCTAATAAAAAATAGATGATAGTTTAAACAGAAAGAAAAAATAC
ATTTTAAGCAAGCAAAATTAATTTATTATAAATTTAATAAATGATAGGGTGTTTAATTAG
CCTTAGATGGTGTTAGAGATTATTTACCTAAGCCTGATGAAAGAAAGAACGTTGGATTTT
TATAAAAAGAAGATACTCAAGCTGAAGAAAAGATTGAATTTATTCCTGATCCTAAACTTC
CTTTTGTTGGTTATGCCTTCAAGCTTGAAGAAAGCAAATTCGGATAATTGACTTACGTTA
GAGTTTACTAAGGTAAGCTTAAGAGAGGTGATAATGTTTATAATACTACTGTCAAAAAGA
GAATGAAAATCTCCAGAATGATTAAAATGCATGCCAATTAGATGGAAGAAATTAATGAAG
CTGGTCCTGGTGAAATTTTCGCTATTTTTGGTGTTGAATGCGCTACTGGTGATACCCTTT
GCGAAGGTGATATGTCTTACACAGTAATTATTTATTAATTTAAATTCAGAATATTTATAA
ATAATTTTATTTTTATTTAGGCTAGATGCAGTAGTATGCACGTCCCAGCTCCAGTCGTTA
ACTTGAGTATTAAGCCCAAGGATAACAAGTCAAGTGCTAAGTTTAATAAAGCCTTGAAGA
AGTTCTCTAGAGAAGATCCCACCTTCAGAGTTAGCATTGATAAAGAAAGTGAAGAAATTG
TTATTTCTGGTATGGGTGAATTGCATTTACAAATCTATGCTGAAAGAATGAGAAGAGAAT
TCGACGTTGATGTCATTCTTGGTAATCCCACTGTCAACTACAGAGAAACTATCACTTAAA
AGGCTCACTTTGATTATCTCCATAAGAAACAATCTGGTGGTGCTGGTCAATTTGCCAGAG
TTATCGGTAATAAGACTATTTTAATATTATCTAATTAATCCTTACTATTAACTATTTAAT
TTAATTGAATTTAGGTTTTGTTGAACCAATGGTCAATCCTGAAGATCCCCAAGATTTTAG
CTGCTAATTCGTTAACAAGGTTATTGGTACCAATGTTCCTAATGAATACGTAACTGCTTG
TGAAAAATCTTTCTACGATGTTATTGATAAGGGTCCTCAAACTGGTTATCCTGTCGTCAA
CATGAAGTTTGTCTTAGAAGATGGTCAAACTCACGTTGTCGATTCTTCTTCTAATGCTTT
CATGATTGCTACTAAATATGCTTTCAACAAGGCCTTCAATGATGCTGGTCCTGTTATTCT
TGAACCTTTTATGAATGTTGAAGTTACTTGCGCCGCTGCTGAATATGTAAATTCACTTTA
AAAAAATAAAAACAAAAATAAGAACTTTTTATTTAAAAAAATAGCAATCTGTTATGGCTG
CCATTTCTAAAAGAAGAGGTTTAATTACTAACACTGAATCAAGAGGTGATATTTTCATTC
TTAATGCTGACTGTCCTCTTTCTTAAATGTTCGGTTTTGCTACTGAATTGAGAGGTTTAA
CATCAGGTCAAGTAAGTTAATAGTTAATTTTAAAAGTAATTAAAAAATATAATATGAATA
ATAGGGTGAATTCTCTATGGAATACAAGAGTCATGAACCTATTGATCCATCCCAAGCTGA
AGAAGTCAAGAAACAATATCAAATTAGAAGAAAGGATAAAGGTCAAGATTGA