Identifiers and Description

Gene Model Identifier

TTHERM_01164190

Standard Name

None

Aliases

PreTt18023 | 260.m00030 | 3796.m00128

Description

Kelch motif family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01164190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20826.19.997093137033517e-262kelch domain-containing protei
n family protein (430 aa)
OxytrichaContig10509.0.g961.000499495426459e-47Kelch motif
Stentor CoeruleusSteCoe_274898.75651076269652e-27
DictyBaseDDB_G02707501.9991095569230066e-20DDB_G0270750 on chromosome: 1
position 4356679 to 4358223
WormBaseWBGene000018270.00000000000001000191320216021locus:hcf-1 status:Confirmed
UniProt:G5EC23 protein_id
:CCD66593.1
SGDYHR158C0.00000000002000577768187062KEL1 Protein required for prop
er cell fusion and cell morpho
logy; functions in a complex w
ith Kel2p to negatively regula
te mitotic exit, interacts wit
h Tem1p and Lte1p; localizes t
o regions of polarized growth;
potential Cdc28p substrate

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01164190(coding)
ATGAATAATATTAATTTAGATAAACTAGCGTAGATGAACTCTACCATTGGAGGATTTTAA
GATATTAAAAAAATACTTAAGTAAAAGTAGAAATAATCATAATAAGAAGGGGTTTAAAAG
TTACATGAAGGCAAAATTGAATAATTTTTAAATTAAACTATTGACTAAACACCCAAAATT
AAGCCCAAAAAATAAATGAATATGACAATTGATTTAGATTTGATAAATAAGAATGATCTT
ATAATTTCAGATACACCAAAATATAAACCATAAATTGTAAGTTTTAAGGAAGGAGATGAT
CATTCTAAATTTGGATGTACCACAAGAAGCAACTTCAAACAAACTTTTGAAAATTTAAAA
CAAAACTAAAGACAGTCATAGCATTCAAAATAATCTTTGTCACTGTAAATTCACTCTTAA
AATAAATTTTTTACTCCGTCTACTCCAAAAGAAATGCAAACAGATTTTAAAAAAAGTAAG
GGTACTTCTCATTCTAGATTTGGTAATATGAGTTTTGGGGGTGATATTTTTTCCCCTACT
GTGCCTTAAGGCTAAGGATAGTTCACTCCTTTTAAAGACATTATTTAAAAGAATCCTTAG
AATATTTTAGATAAATTTTTTAACTAAAATCTAAGCAGCCAAGAGAAAATAAAGCAAAAA
TTAATACACAATAGTGAATAAATGAACTTGATCAAAGATTAGCTTGAAATCCAAAGGATT
AGTAGCTTTGAAAATTACATCAGCATCAAAAAATATTCTGACAGCTTAATAAATAAATCA
GCAACTTAAAAAAAATTACCTTAATAAAATAATTATAGTAGATTAAATAAATTTCCTTTT
AACAGTTAATAAATGCCCCTAATAATAAATCCTGCGATATTCAATTAGTAGCTTCAAAAT
AATCAGTAACTTGGAGGTAATTCTCAGTTCTCAAATACTGAAATAGAAGAACAAGGTGAT
TCAAATCAAAATTAATAGATAGAACTGTAGTTCCATTGGGAAAAGGTAGTTAATTATAGC
TCTTAGCTAAAGCCTGAGTTCAGAGAGGGAGCTTCTTTACTAGAATATAACCAAAATCTA
TATTTATTTGGAGGATTTGGTTTTTAGTTATTTAACTCCCTTTACCAGTTCAGTCTAAAG
GATTATGAGTGGAAAAAGACAGAAACAAACGGATTTTATGGTAACCAAAGTGGGCGTTTT
GGACATTCTGCTAATTTATATAAAAACTAAATGGTTATATTTGGCGGTGCTTCAGAGTAC
AGCTCAAAATTGAAAAATAGAGCTGTTATGAATGATGTATGGATGCTAAATTTAGATAAC
CATGAGTGGAAGCAGATTAGAACAATAGGGGATTATGTAGAGCCTAGAAGAAATCATGCA
ACTTGTATAGTTGGAAATCACTTTTATGCACATGGTGGAGTAGGAAATTATGAAAAATAT
TTAAATTAATTGAATGTGCTTTCATTAGATAAAGGGAGATGGAAATCTTTCTAATTCAAA
TTTGATGAGTAGGGAATAGCTTTCCACTAAATGGTGCCAATATTTTAAAAGAGCTTGAAA
TTTATTTCAAGAAAAGCAGAAAAAATGGGCAAAATGGTGAGTTCTAAAAATAAATTCAAA
GTGAAGGAAGAAGGAATTTATTGCTTCGGAGGTAAATAAGGCAACTAAAAAATAAGAGGC
AAACTTATTATATTAAAATTAGACTAAAAGGAATAACCTGTTGACTGGATAATACCTGAG
ACCTCTGGATAAAGTCCTCATCCAAGATTTCATCATAGCATGATCTTTAACTATTATGTA
AAGGGAATTGTTTTATTTGGAGGAGTCAATGATGAAGCTAATATGCCAGAATATGCATTT
TAAGATGTGTGGATACTTTAGCTGAATAATTTAAATTGGATTTAGATTAATGTAAGTGGA
TAAAATAATAGGCATAGATTTGCTCATTCTTTTACTTCTATCGATGAACGTATATTTATT
TTTGGTGGAGCATCTAATCAAAGCTATACTGACTGCGAGTTATATGTATTAGAAATGAAT
TAATAAGTAGCAAAACAAAAAAAAAGCAACCCAGTAAGAGATTTTGCTACAAGATAAATG
TCTCTTGATAGATTAGAAGTAGAGGAAAATAAACATATTTCTTATTTAGAAAGAAAAATT
AATTTTTCAAATACCAATAGATCTAGCGAAAATAAAAGCTTTTTAAGACCTCCTTCTAAA
AAGTTTTTAAAAAGCTAACCAGAAAGCATGTTTATAAGCTTAGACAGTTCAAGAAAAAAC
TAAATGTAAACATCAAATTCACCTCAATCATGTGCTTTAAGTCCAAGGTAAAAGTAGGAA
ATGGCACAGAGGCCAAAGCTTCAGTCCCTTTTTTCGCATTACTTGAGTTGA


>TTHERM_01164190(protein)
MNNINLDKLAQMNSTIGGFQDIKKILKQKQKQSQQEGVQKLHEGKIEQFLNQTIDQTPKI
KPKKQMNMTIDLDLINKNDLIISDTPKYKPQIVSFKEGDDHSKFGCTTRSNFKQTFENLK
QNQRQSQHSKQSLSLQIHSQNKFFTPSTPKEMQTDFKKSKGTSHSRFGNMSFGGDIFSPT
VPQGQGQFTPFKDIIQKNPQNILDKFFNQNLSSQEKIKQKLIHNSEQMNLIKDQLEIQRI
SSFENYISIKKYSDSLINKSATQKKLPQQNNYSRLNKFPFNSQQMPLIINPAIFNQQLQN
NQQLGGNSQFSNTEIEEQGDSNQNQQIELQFHWEKVVNYSSQLKPEFREGASLLEYNQNL
YLFGGFGFQLFNSLYQFSLKDYEWKKTETNGFYGNQSGRFGHSANLYKNQMVIFGGASEY
SSKLKNRAVMNDVWMLNLDNHEWKQIRTIGDYVEPRRNHATCIVGNHFYAHGGVGNYEKY
LNQLNVLSLDKGRWKSFQFKFDEQGIAFHQMVPIFQKSLKFISRKAEKMGKMVSSKNKFK
VKEEGIYCFGGKQGNQKIRGKLIILKLDQKEQPVDWIIPETSGQSPHPRFHHSMIFNYYV
KGIVLFGGVNDEANMPEYAFQDVWILQLNNLNWIQINVSGQNNRHRFAHSFTSIDERIFI
FGGASNQSYTDCELYVLEMNQQVAKQKKSNPVRDFATRQMSLDRLEVEENKHISYLERKI
NFSNTNRSSENKSFLRPPSKKFLKSQPESMFISLDSSRKNQMQTSNSPQSCALSPRQKQE
MAQRPKLQSLFSHYLS


>TTHERM_01164190(gene)
ATGAATAATATTAATTTAGATAAACTAGCGTAGAGTAACATTATTGATCAACATTCTAAT
ACCTTTAACTTTTATAATTAATATTTAGTGAACTCTACCATTGGAGGATTTTAAGATATT
AAAAAAATACTTAAGTAAAAGTAGAAATAATCATAATAAGAAGGGGTTTAAAAGTTACAT
GAAGGCAAAATTGAATAATTTTTAAATTAAACTATTGACTAAACACCCAAAATTAAGCCC
AAAAAATAAATGAATATGACAATTGATTTAGATTTGATAAATAAGAATGATCTTATAATT
TCAGATACACCAAAATATAAACCATAAATTGTAAGTTTTAAGGAAGGAGATGATCATTCT
AAATTTGGATGTACCACAAGAAGCAACTTCAAACAAACTTTTGAAAATTTAAAACAAAAC
TAAAGACAGTCATAGCATTCAAAATAATCTTTGTCACTGTAAATTCACTCTTAAAATAAA
TTTTTTACTCCGTCTACTCCAAAAGAAATGCAAACAGATTTTAAAAAAAGTAAGGGTACT
TCTCATTCTAGATTTGGTAATATGAGTTTTGGGGGTGATATTTTTTCCCCTACTGTGCCT
TAAGGCTAAGGATAGTTCACTCCTTTTAAAGACATTATTTAAAAGAATCCTTAGAATATT
TTAGATAAATTTTTTAACTAAAATCTAAGCAGCCAAGAGAAAATAAAGCAAAAATTAATA
CACAATAGTGAATAAATGAACTTGATCAAAGATTAGCTTGAAATCCAAAGGATTAGTAGC
TTTGAAAATTACATCAGCATCAAAAAATATTCTGACAGCTTAATAAATAAATCAGCAACT
TAAAAAAAATTACCTTAATAAAATAATTATAGTAGATTAAATAAATTTCCTTTTAACAGT
TAATAAATGCCCCTAATAATAAATCCTGCGATATTCAATTAGTAGCTTCAAAATAATCAG
TAACTTGGAGGTAATTCTCAGTTCTCAAATACTGAAATAGAAGAACAAGGTGATTCAAAT
CAAAATTAATAGATAGAACTGTAGTTCCATTGGGAAAAGGTAGTTAATTATAGCTCTTAG
CTAAAGCCTGAGTTCAGAGAGGGAGCTTCTTTACTAGAATATAACCAAAATCTATATTTA
TTTGGAGGATTTGGTTTTTAGTTATTTAACTCCCTTTACCAGTTCAGTCTAAGTAATTTT
TATATTTGATAATATTAATATTCTATCTTAATTTTATTTAATTTGGCTTTATTGTGATGA
ATTTTTATTTTAATTTTGTTAAAATCTAAATTTTATTGATAAATTTTAGAGGATTATGAG
TGGAAAAAGACAGAAACAAACGGATTTTATGGTAACCAAAGTGGGCGTTTTGGACATTCT
GCTAATTTATATAAAAACTAAATGGTTATATTTGGCGGTGCTTCAGAGTACAGCTCAAAA
TTGAAAAATAGAGCTGTTATGAATGATGTATGGATGCTAAATTTAGATAACCATGAGTGG
AAGCAGATTAGAACAATAGGGGATTATGTAGAGCCTAGAAGAAATCATGCAACTTGTATA
GTTGGAAATCACTTTTATGCACATGGTGGAGTAGGAAATTATGAAAAATATTTAAATTAA
TTGAATGTGCTTTCATTAGGTAAATACTTTAATATGTTCTAACTTGAATGAAGAATACAA
TTAACAAATATTTAGATAAAGGGAGATGGAAATCTTTCTAATTCAAATTTGATGAGTAGG
GAATAGCTTTCCACTAAATGGTGCCAATATTTTAAAAGAGCTTGAAATTTATTTCAAGAA
AAGCAGAAAAAATGGGCAAAATGGTGAGTTCTAAAAATAAATTCAAAGTATTTTTTTAAT
ATTTTTAGTGAAGATTGAAATGTTGATTTTTTAAATAATTGAAAAGGTGAAGGAAGAAGG
AATTTATTGCTTCGGAGGTAAATAAGGCAACTAAAAAATAAGAGGCAAACTTATTATATT
AAAATTAGGTAAATATTTTATATATATTTGCTATTATTAATTTCTTCTAAATTGACAGAC
TAAAAGGAATAACCTGTTGACTGGATAATACCTGAGACCTCTGGATAAAGTCCTCATCCA
AGATTTCATCATAGCATGATCTTTAACTATTATGTAAAGGGAATTGTTTTATTTGGAGGA
GTCAATGATGAAGCTAATATGCCAGAATATGCATTTTAAGATGTGTGGATACTTTAGCTG
AATAATTTAAATTGGATTTAGATTAATGTAAGTGGATAAAATAATAGGCATAGATTTGCT
CATTCTTTTACTTCTATCGATGAACGTATATTTATTTTTGGTGGAGCATCTAATCAAAGC
TATACTGACTGCGAGTTATATGTATTAGAAATGAGTAAGTTCATATTCAAAGTTAATAAT
ACTCTTATTTTAAAAATTATTTTTACACAGATTAATAAGTAGCAAAACAAAAAAAAAGCA
ACCCAGTAAGAGATTTTGCTACAAGATAAATGTCTCTTGATAGATTAGAAGTAGAGGAAA
ATAAACATATTTCTTATTTAGAAAGAAAAATTAATTTTTCAAATACCAATAGATCTAGCG
AAAATAAAAGCTTTTTAAGACCTCCTTCTAAAAAGTTTTTAAAAAGCTAACCAGAAAGCA
TGTTTATAAGCTTAGACAGTTCAAGAAAAAACTAAATGTAAACATCAAATTCACCTCAAT
CATGTGCTTTAAGTCCAAGGTAAAAGTAGGAAATGGCACAGAGGCCAAAGCTTCAGTCCC
TTTTTTCGCATTACTTGAGTTGA