Identifiers and Description

Gene Model Identifier

TTHERM_01122670

Standard Name

None

Aliases

PreTt24588 | 243.m00037

Description

F-box-like protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.2%

TetraMine Data

TTHERM_01122670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10601.19.997093137033517e-262F-box domain-containing protei
n (462 aa)
OxytrichaContig18980.0.g970.00000000019994075865167896Leucine rich repeat
WormBaseWBGene000208840.00010003404299092957status:Confirmed UniProt:H2K
ZV2 protein_id:CCD69936.1
DictyBaseDDB_G02765290.0007003012208360162DDB_G0276529 on chromosome: 2
position 6780883 to 6787558

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01122670(coding)
ATGGAACAGGAAAATAGAATAAATTTTAGTATTTAAAACTTAAGCGATGATATCTTAATG
GATATTTTTAGGTTTCTTACAATTAAAGATATAGCATTAATTTAGTTGATAAACAAAGAG
TGGAAAAAGTGTACAGAAAAGCCATTTTTGTGGCGTAGAATTAAATATGATTTTTAAGAA
CATGAAATTTAAGATAAGAAACTATATATTAGATGGATAATAGAAAAAATTAATATTTAT
GATGTAGAATAGTTAATCATTAATGATCCCAACTGCCATTTGACATTTTAAGATATTTAT
TAAATCCTAACAAAAAACTTTAATTCATTGTAAGATCTTGAGTTATCTATTTATAATCTT
AACGAATCATAAGCAAACATCATTAGTCTTTTGATTGTCAAGAATTGTCCTAATTTAAGA
TCGTTTACAACTTATGGCTGTTTCGCTATGGATTAGTTTATAGAGCACTTTTAATTACTT
AATAAACTAGATTCTTTATCTATTATGTGTAGTGATAATTCCTTCACAGGTAGGTATTTG
AAAACTTTGCCTCCTTTAAAAAAATTATTTTTAAGACCATACCTGATAGAGTATAGTAAT
ATATTAGAAGTCATTAGAAAAGGGAAAAATACATTAGAAGAATTAGCTATCGACACTGAG
TAGATGGATGATGATTAGATTATCAAATTGTTTAATGAGTTAAACAAAACTAAAATTTAG
TCGCTATTACTCAATTACTGTGAGTATTTTTAAGATGAAGTCTTTAATTATTTGAGATAA
TTCACTCAATTAAAAAGATTAAAGTTTTATAAAGCCAACGAAGTAACCTAAGAAGGTTAT
TTTAATTGCTTCCAAAATTTTGCAAGCACATCATTGATCCACTTGAATTTGAAAGAATGT
AATGAGTTAGATGATGAAGGCTTGATAAGCATTTTGTCTAAAAGTACTCAGTTAGAATGT
TTAAAATTGGCTTGGCAGAAAAATGTTACTTCAGAATCAATCAGATACCTTTTTTCTAAT
TGCTTTAACCTATAAACTTGCGTCTTGATAGGAATTAAATCATTAGATGCTAGAGGATTT
CCAGCTATTCAAGAACTATAATAATACTTTGAAGTTTAAAAATATGGCGAATTAAAAAGA
AATAATTAATATCAAGACGATTACAATAATGATTGCATAAATAACCGAGCATATACTTCT
ATTGACATCTAAAATTATTTCTCAAAACCAATAGGCAAAACCTCTATCATAAAATATTAT
CAAAAGCTAAGATTTATAGATTGTACCAAGTCTGACATGGTTCCAGATTAAATATTATAG
ATTTTACATTTATTTAAACCATATCTGGTAGCTCGTAATTATTATAGTGAAGAAATGTGA


>TTHERM_01122670(protein)
MEQENRINFSIQNLSDDILMDIFRFLTIKDIALIQLINKEWKKCTEKPFLWRRIKYDFQE
HEIQDKKLYIRWIIEKINIYDVEQLIINDPNCHLTFQDIYQILTKNFNSLQDLELSIYNL
NESQANIISLLIVKNCPNLRSFTTYGCFAMDQFIEHFQLLNKLDSLSIMCSDNSFTGRYL
KTLPPLKKLFLRPYLIEYSNILEVIRKGKNTLEELAIDTEQMDDDQIIKLFNELNKTKIQ
SLLLNYCEYFQDEVFNYLRQFTQLKRLKFYKANEVTQEGYFNCFQNFASTSLIHLNLKEC
NELDDEGLISILSKSTQLECLKLAWQKNVTSESIRYLFSNCFNLQTCVLIGIKSLDARGF
PAIQELQQYFEVQKYGELKRNNQYQDDYNNDCINNRAYTSIDIQNYFSKPIGKTSIIKYY
QKLRFIDCTKSDMVPDQILQILHLFKPYLVARNYYSEEM


>TTHERM_01122670(gene)
ATGGAACAGGAAAATAGAATAAATTTTAGTATTTAAAACTTAAGCGATGATATCTTAATG
GATATTTTTAGGTTTCTTACAATTAAAGATATAGCATTAATTTAGTTGATAAACAAAGAG
TGGAAAAAGTGTACAGAAAAGCCATTTTTGTGGCGTAGAATTAAATATGATTTTTAAGAA
CATGAAATTTAAGATAAGAAACTATATATTAGATGGATAATAGAAAAAATTAATATTTAT
GATGTAGAATAGTTAATCATTAATGATCCCAACTGCCATTTGACATTTTAAGATATTTAT
TAAATCCTAACAAAAAACTTTAATTCATTGTAAGATCTTGAGTTATCTATTTATAATCTT
AACGAATCATAAGCAAACATCATTAGTCTTTTGATTGTCAAGAATTGTCCTAATTTAAGA
TCGTTTACAACTTATGGCTGTTTCGCTATGGATTAGTTTATAGAGCACTTTTAATTACTT
AATAAACTAGATTCTTTATCTATTATGTGTAGTGATAATTCCTTCACAGGTAGGTATTTG
AAAACTTTGCCTCCTTTAAAAAAAGTAATATTATTAACTCCTAAAAAAGGAAAAATTAAA
TATTTAATAAATTATTTTCAAATTCAGTTAATAGATTCATATAAATTGAATAAAAATATT
TATTTGAAAAATATTAAAAATATTTTTTATTTAAATTTATTTAATTATTATATTTTAATT
TTAGTTATTTTTAAGACCATACCTGATAGAGTATAGTAATATATTAGAAGTCATTAGAAA
AGGGAAAAATACATTAGAAGAATTAGCTATCGACACTGAGTAGATGGATGATGATTAGAT
TATCAAATTGTTTAATGAGTTAAACAAAACTAAAATTTAGTCGCTATTACTCAATTACTG
TGAGTATTTTTAAGATGAAGTCTTTAATTATTTGAGATAATTCACTCAATTAAAAAGATT
AAAGTTTTATAAAGCCAACGAAGTAACCTAAGAAGGTTATTTTAATTGCTTCCAAAATTT
TGCAAGCACATCATTGATCCACTTGAATTTGAAAGAATGTAATGAGTTAGATGATGAAGG
CTTGATAAGCATTTTGTCTAAAAGTACTCAGTTAGAATGTTTAAAATTGGCTTGGCAGAA
AAATGTTACTTCAGAATCAATCAGATACCTTTTTTCTAATTGCTTTAACCTATAAACTTG
CGTCTTGATAGGAATTAAATCATTAGATGCTAGAGGATTTCCAGCTATTCAAGAACTATA
ATAATACTTTGAAGTTTAAAAATATGGCGAATTAAAAAGAAATAATTAATATCAAGACGA
TTACAATAATGATTGCATAAATAACCGAGCATATACTTCTATTGACATCTAAAATTATTT
CTCAAAACCAATAGGCAAAACCTCTATCATAAAATATTATCAAAAGCTAAGATTTATAGA
TTGTACCAAGTCTGACATGGTTCCAGATTAAATATTATAGATTTTACATTTATTTAAACC
ATATCTGGTAGCTCGTAATTATTATAGTGAAGAAATGTGA