Identifiers and Description

Gene Model Identifier

TTHERM_01119540

Standard Name

None

Aliases

PreTt14793 | 242.m00040

Description

DNA-directed RNA polymerase; DNA-dependent RNA polymerase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00940 ) DNA-dependent RNA polymerase
  • ( TIGR02209 ) cell division protein FtsL

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_01119540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_362660
Tetrahymena borealisEI9_20071.19.997093137033517e-262DNA-dependent RNA polymerase (
1143 aa)
OxytrichaContig6434.0.g989.997093137033517e-262DNA-dependent RNA polymerase
DictyBaseDDB_G02674169.996149531968772e-161rpmA on chromosome: 1 position
950030 to 952882
SGDYFL036W3.000742025943196e-157RPO41 Mitochondrial RNA polyme
rase; single subunit enzyme si
milar to those of T3 and T7 ba
cteriophages; requires a speci
ficity subunit encoded by MTF1
for promoter recognition
WormBaseWBGene000136807.001437662516688e-113locus:rpom-1 DNA-directed RN
A polymerase status:Partiall
y_confirmed UniProt:Q8WQA3
protein_id:CAD21670.3

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01119540(coding)
ATGTTAGCATTTATTTCTAAGCAAAGTTCATACGGAGTAACAAATCGTGTTATTCATAGC
TATAAGCAATTACTCTCCAACACTAGCAATAGTTGCATATATAGATCTAATCAAATATCT
TTTAATGGAGCAACTTCATTTGTCAATTAATAAAAATACTTGCATGCAAATCTAAATCAA
AATGTGAAAATGTTTGATGTTTAGCACAATTTATTTAATGGCTCTGTCAAATAAACAAAT
GAGCCCGCTACAACTTCAAACAATCAAACTCTTTAACAGCTTTTCGAATAAGTCAAACCA
AAAACTCTTTTTGAAAAGGAAAAGCAATAGTAAGAGCTTTATCATTTATAATATAAGCAC
ATTCGCAAGGAGTATCTCATCGAAGGTGCTCGCGCTTCTCAAATTTTAATTCAATTAGAT
GGCAATCTGCTTGAGGATTGCTGCTAAATTTTCTTTAATGAATTCTTAAGCAACAGAGAA
AAAGTTCCAAGCAAAATTTCTTTGGCTATTGAAAAGTGTTATAATGAAAAACTAGAACGC
TTCATCACAGAAGAAGAAAGAATCATTCGTGATGATCCCTATAAAATAGCAGAGAGATCT
CAGGAGATATTTAAAAGCTTGAAAATAATATTAGAAATAATGGATAAAGGAAATAAGGGA
TTATTGACAGGCGATTTGCATCCTAAATTAATAGATGGATGCAGCAAGGTATTTCCAGAA
ACTCTAAAAAAGCTTTAGGAGTTTTAGCATTAGAATATCGATGGAGGCAGTAGCTTGTCA
TTTGAATAGATTGTAGATAGCATGTACAACACAATTTCTGTTTATGCTTTTTAGGAAATG
TTTAAACTGCCTTTATATGGAATTAAATATCCTGATTTAGAAAATAAAAGAAATTTGTTT
GAGAGACAGCTTATCTTGGAATAGGAATCTTAGTCTTAGGCAGTCAATAAGTTCTTGAAG
GTTTACGAAGATTTGAATAAGTTTGGGTTGGCTGTCAATATAGGATTTGCAAAAAGATAT
ATTATGAATTGGTTTCCTAATTTGTGCAAGGTCATTAAAGAAGAGTAGCAACAGTGTTTA
TTAGGAGAACTAAAGGGAGAAAGAAAATATTATGCAACATATTTGACAAAGCTTTCTGCA
GAGAGAATAGCTATTTTGAGTTTAACTGAGTTGATGAAGCAGATTTTGCGTATTTCCAAT
AAATTCAAAGAAAGCGCTGAGAACATGGAAAACACAATCGTTGATTGCAGCATTGTTTCT
AAAGCCATTTTTTCATCTATTGGTGAAGCCGTAAATTTGCAATACATTTATGAGTAAGAA
GAGAAGCTGAATAAAGAAAAGGAAAAGAAAGATCTCGAAAGTTTGGTTGAGAAGATAAAT
TCTAATAACACTTCTAACTCTTCTGAAGAGGAAGTCACTCAACGTGCTAAAAAGTATCTT
GCTGACAAAACAAAGGAAGCCAATTAAAAGATCATGGAGAGTCTTTACAAAAAGAAGAAT
TCCACTTCTAAATTGAATTATTAAGAAATAGGAATTCCCAAGACCATCTAGCTTAAGATC
GGCTCTCTCTTAATTTATTTGATGAAAGAGACTATTCAAATAAGAAATGAATAGAATTTC
TGGATTCATTTGCTTGTTCCTTCCTACAAAAAGTCAAAGAATAATGATGGTTATGTTGGT
GTTATCAATATTAATGAAGACTTTATCATTTCTCTCTATGAATAGTCAGAAAAGAGTGAG
TCTCCTTTCATGCATCTAGAAAGATGTCTGCCAATGATCTACAAACCTGCTCCTTGGTAA
GACTACGAAATTGGAGGATATTACTAACGTCCCACAAATCTCATGCGTATCCACGAATCT
CCAATTTAAGAAAAAGTTTTATCCTACTCTGATCTCTCTAAAATGTACAACATCTTAAAC
ACAGTCAGTCAGACAGCTTGGAGAATTAACAAAAAAGTTTTTGATGTCATGGAAAAAATT
TGGGAAGAAGGTGGTGGCTAAGGTGAAATTCCTCGCCGTTTTTATGATTACAAAGACTAT
GTTTATCAATATTAACTCAAGGAGTGCAAGAATAGAGATGAATAATAAAGACTGATGAAG
AAAATTTAGGAACAAAGAGATATGCATTCAATGAGAAGTGATTTCTAACTCAAAATTAAT
GTTGCAAAGGCATTCAGAAACATAGAAAAGATTTATTTCCCTCATAATGTCGATTTCAGA
GGTCGTATTTATCCTATCCCTCCTCATTTGAATCACATGGGTGCAGATATTTCTCGTGGT
CTCCTCGAGTATTCAGAGAGCAAGAAAATTGGAAAAACCGGCTGGTATTGGCTTAAGGTT
CATCTTTCCAATTTACTTGGTTAGGACAAGCTTTCCTTCCCCGAAAGAGTCGCATTTGCT
GAATCTTAATTTGAAAACGTAAAAAGATGGGCTTCCGATCCATTGAAACACAGAGAATGG
ATTCAAGTCGAAGACGCATGGTAAGCTCTTGCTACAATTTTCGATGTAGCTGAAGCACTC
AAGCTAGAAAACCCAGAAGATTACATTTCTCACTTGCACGTTCACATGGATGGTTCATGT
AACGGTCTACAGCATTATGCAGCTATTGGTAGAGATAAAGATGGTGCCATGCAGGTTAAT
CTGATGAATGCTTAAAAGCCAGGTGATTTGTACAGTCACGTAGCAAGAATGGTCGAACAA
AGAGTAGGAAAAGATGCAAATGATGACTTAGCTAAGTATAATGCAATCGCTAAAAAGCTA
TCTGGTAACATCAAGAGAAAAGTAGTTAAATAAACAGTTATGACATCAGTCTACGGTGTC
ACCTTCGTAGGTGCAAGAAAGTAGATTTATAAGCAATTAAGAGATAAAGATTTCCTAACA
GAAGAAGAAGCCTATGAAGCATCTTATTACTTAGCCCAAACAACTCTAGACTGTATTAAA
GATCTTTTCAGTTCTGCTCACTACATCAAAAAGTGGTTAATTAACTGTGCAGGTCTCATT
GCAAACACATCTAATCCCGTCAGTTGGATCACTCCTATGGGCTTGCCTGTTGTTCAACCT
TATAGATCAAAGGGACAATTAGATGTGATTAACACTGTGATACAAAAAATAGCAGTAGAA
CAAGATTCAGATAGACTACCCATAAATAAGTCAAAATAAAGATCTGCCTTCCCTCCCAAT
TATATTCACTCTCTCGATTCTACTCACTTGATGTACACCGCTTTAGAATGTATCAAACGT
GGCATGCATTTTGCAGCTGTTCACGATTCTTATTGGACTCACGCCTGCGATATTGAAGAA
ATGCACAAAATTTTGAGAGAACAATTCGTTAAATTGCACAGCCAACCTCTGCTTGAAGAC
TTAAAAGCATCCTTCGAAAGAAGATATCCAAACATAGAATTCCCAGAGATTCCAAACAGA
GGACTACTCGATTTAGAAGAAGTTAAAAAGAGTACTTATTTCTTTTGTTGA


>TTHERM_01119540(protein)
MLAFISKQSSYGVTNRVIHSYKQLLSNTSNSCIYRSNQISFNGATSFVNQQKYLHANLNQ
NVKMFDVQHNLFNGSVKQTNEPATTSNNQTLQQLFEQVKPKTLFEKEKQQQELYHLQYKH
IRKEYLIEGARASQILIQLDGNLLEDCCQIFFNEFLSNREKVPSKISLAIEKCYNEKLER
FITEEERIIRDDPYKIAERSQEIFKSLKIILEIMDKGNKGLLTGDLHPKLIDGCSKVFPE
TLKKLQEFQHQNIDGGSSLSFEQIVDSMYNTISVYAFQEMFKLPLYGIKYPDLENKRNLF
ERQLILEQESQSQAVNKFLKVYEDLNKFGLAVNIGFAKRYIMNWFPNLCKVIKEEQQQCL
LGELKGERKYYATYLTKLSAERIAILSLTELMKQILRISNKFKESAENMENTIVDCSIVS
KAIFSSIGEAVNLQYIYEQEEKLNKEKEKKDLESLVEKINSNNTSNSSEEEVTQRAKKYL
ADKTKEANQKIMESLYKKKNSTSKLNYQEIGIPKTIQLKIGSLLIYLMKETIQIRNEQNF
WIHLLVPSYKKSKNNDGYVGVININEDFIISLYEQSEKSESPFMHLERCLPMIYKPAPWQ
DYEIGGYYQRPTNLMRIHESPIQEKVLSYSDLSKMYNILNTVSQTAWRINKKVFDVMEKI
WEEGGGQGEIPRRFYDYKDYVYQYQLKECKNRDEQQRLMKKIQEQRDMHSMRSDFQLKIN
VAKAFRNIEKIYFPHNVDFRGRIYPIPPHLNHMGADISRGLLEYSESKKIGKTGWYWLKV
HLSNLLGQDKLSFPERVAFAESQFENVKRWASDPLKHREWIQVEDAWQALATIFDVAEAL
KLENPEDYISHLHVHMDGSCNGLQHYAAIGRDKDGAMQVNLMNAQKPGDLYSHVARMVEQ
RVGKDANDDLAKYNAIAKKLSGNIKRKVVKQTVMTSVYGVTFVGARKQIYKQLRDKDFLT
EEEAYEASYYLAQTTLDCIKDLFSSAHYIKKWLINCAGLIANTSNPVSWITPMGLPVVQP
YRSKGQLDVINTVIQKIAVEQDSDRLPINKSKQRSAFPPNYIHSLDSTHLMYTALECIKR
GMHFAAVHDSYWTHACDIEEMHKILREQFVKLHSQPLLEDLKASFERRYPNIEFPEIPNR
GLLDLEEVKKSTYFFC


>TTHERM_01119540(gene)
ATGTTAGCATTTATTTCTAAGCAAAGTTCATACGGAGTAACAAATCGTGTTATTCATAGC
TATAAGCAATTACTCTCCAACACTAGCAATAGTTGCATATATAGATCTAATCAAATATCT
TTTAATGGAGCAACTTCATTTGTCAATTAATAAAAATACTTGCATGCAAATCTAAATCAA
AATGTGAAAATGTTTGATGTTTAGCACAATTTATTTAATGGCTCTGTCAAATAAACAAAT
GAGCCCGCTACAACTTCAAACAATCAAACTCTTTAACAGCTTTTCGAATAAGTCAAACCA
AAAACTCTTTTTGAAAAGGAAAAGCAATAGTAAGAGCTTTATCATTTATAATATAAGCAC
ATTCGCAAGGAGTATCTCATCGAAGGTGCTCGCGCTTCTCAAATTTTAATTCAATTAGAT
GGCAATCTGCTTGAGGATTGCTGCTAAATTTTCTTTAATGAATTCTTAAGCAACAGAGAA
AAAGTTCCAAGCAAAATTTCTTTGGCTATTGAAAAGTGTTATAATGAAAAACTAGAACGC
TTCATCACAGAAGAAGAAAGAATCATTCGTGATGATCCCTATAAAGTAATCAACTATTTA
TTTATTTATTTACTAACTTACTTAATTCTTTTTTAAAGTAATTCTACCAAGGCTTAATCT
CAAATTTTCCAAACAAATCAATAAAAAAAATAACAAATAAATATGGTTAATACTTCATTT
AATATCTTAAAATTACATAATCAATAGCATTACTCTAAATTTTCATCCCCCTCTTTAATT
TAAAATGAAAGAAAATATTTAAAACCTATTTATAAAATAAAAATGATTTTGAAAGCCGAG
AAGGGAATGAAAAGAGGAAAAAATGGGTTATATAAATTATGTTTAATAAAATAAAAATAG
ATAGCAGAGAGATCTCAGGAGATATTTAAAAGCTTGAAAATAATATTAGAAATAATGGAT
AAAGGAAATAAGGGATTATTGACAGGCGATTTGCATCCTAAATTAATAGATGGATGCAGC
AAGGTATTTCCAGAAACTCTAAAAAAGCTTTAGGAGTTTTAGCATTAGAATATCGATGGA
GGCAGTAGCTTGTCATTTGAATAGATTGTAGATAGCATGTACAACACAATTTCTGTTTAT
GCTTTTTAGGAAATGTTTAAACTGCCTTTATATGGAATTAAATATCCTGATTTAGAAAAT
AAAAGAAATTTGTTTGAGAGACAGCTTATCTTGGAATAGGAATCTTAGTCTTAGGCAGTC
AATAAGTTCTTGAAGGTTTACGAAGATTTGAATAAGTTTGGGTTGGCTGTCAATATAGGA
TTTGCAAAAAGATATATTATGAATTGGTTTCCTAATTTGTGCAAGGTCATTAAAGAAGAG
TAGCAACAGTGTTTATTAGGAGAACTAAAGGGAGAAAGAAAATATTATGCAACATATTTG
ACAAAGCTTTCTGCAGAGAGAATAGCTATTTTGAGTTTAACTGAGTTGATGAAGCAGATT
TTGCGTATTTCCAATAAATTCAAAGAAAGCGCTGAGAACATGGAAAACACAATCGTTGAT
TGCAGCATTGTTTCTAAAGCCATTTTTTCATCTATTGGTGAAGCCGTAAATTTGCAATAC
ATTTATGAGTAAGAAGAGAAGCTGAATAAAGAAAAGGAAAAGAAAGATCTCGAAAGTTTG
GTTGAGAAGATAAATTCTAATAACACTTCTAACTCTTCTGAAGAGGAAGTCACTCAACGT
GCTAAAAAGTATCTTGCTGACAAAACAAAGGAAGCCAATTAAAAGATCATGGAGAGTCTT
TACAAAAAGAAGAATTCCACTTCTAAATTGAATTATTAAGAAATAGGAATTCCCAAGACC
ATCTAGCTTAAGATCGGCTCTCTCTTAATTTATTTGATGAAAGAGACTATTCAAATAAGA
AATGAATAGAATTTCTGGATTCATTTGCTTGTTCCTTCCTACAAAAAGTCAAAGAATAAT
GATGGTTATGTTGGTGTTATCAATATTAATGAAGACTTTATCATTTCTCTCTATGAATAG
TCAGAAAAGAGTGAGTCTCCTTTCATGCATCTAGAAAGATGTCTGCCAATGATCTACAAA
CCTGCTCCTTGGTAAGACTACGAAATTGGAGGATATTACTAACGTCCCACAAATCTCATG
CGTATCCACGAATCTCCAATTTAAGAAAAAGTTTTATCCTACTCTGATCTCTCTAAAATG
TACAACATCTTAAACACAGTCAGTCAGACAGCTTGGAGAATTAACAAAAAAGTAAAAATT
AATTTTTATTCATTTAAATAAAATAAAAAAACATAGAAATTTTATTCATTTTAATTTGTT
ATTTAAAGGTTTTTGATGTCATGGAAAAAATTTGGGAAGAAGGTGGTGGCTAAGGTGAAA
TTCCTCGCCGTTTTTATGATTACAAAGACTATGTTTATCAATATTAACTCAAGGAGTGCA
AGAATAGAGATGAATAATAAAGACTGATGAAGAAAATTTAGGAACAAAGAGATATGCATT
CAATGAGAAGTGATTTCTAACTCAAAATTAATGTTGCAAAGGCATTCAGAAACATAGAAA
AGATTTATTTCCCTCATAATGTCGATTTCAGAGGTCGTATTTATCCTATCCCTCCTCATT
TGAATCACATGGGTGCAGATATTTCTCGTGGTCTCCTCGAGTATTCAGAGAGCAAGAAAA
TTGGAAAAACCGGCTGGTATTGGCTTAAGGTTCATCTTTCCAATTTACTTGGTTAGGACA
AGCTTTCCTTCCCCGAAAGAGTCGCATTTGCTGAATCTTAATTTGAAAACGTAAAAAGAT
GGGCTTCCGATCCATTGAAACACAGAGAATGGATTCAAGTCGAAGACGCATGGTAATTTC
TAAATAATTTGTTTTTAAATGAAAAATAATTTGAATGAATAACTTAAAGGTAAGCTCTTG
CTACAATTTTCGATGTAGCTGAAGCACTCAAGCTAGAAAACCCAGAAGATTACATTTCTC
ACTTGCACGTTCACATGGATGGTTCATGTAACGGTCTACAGCATTATGCAGCTATTGGTA
GAGATAAAGATGGTGCCATGCAGGTAAAAAAAGAACCAAATATATTCATAAAATTTATTA
AAAAATAAAATTAAAAAGGTTAATCTGATGAATGCTTAAAAGCCAGGTGATTTGTACAGT
CACGTAGCAAGAATGGTCGAACAAAGAGTAGGAAAAGATGCAAATGATGACTTAGCTAAG
TATAATGCAATCGCTAAAAAGCTATCTGGTAACATCAAGAGAAAAGTAGTTAAATAAACA
GTTATGACATCAGTCTACGGTGTCACCTTCGTAGGTGCAAGAAAGTAGATTTATAAGCAA
TTAAGAGATAAAGATTTCCTAACAGAAGAAGAAGCCTATGAAGCATCTTATTACTTAGCC
CAAACAACTCTAGACTGTATTAAAGATCTTTTCAGTTCTGCTCACTACATCAAAAAGTGG
TTAATTAACTGTGCAGGTCTCATTGCAAACACATCTAATCCCGTCAGTTGGATCACTCCT
ATGGGGTAATTCTTTTGTTAAAAATAAATAAATAAATACACCCCAAAAAAAATGTCTTCA
TTTAAATAACTTCTCCATAAAAATCAAGAATTAGTTTCTAATAAATCAAAAGAAAAATTC
AAAAAAAGATTTTTTTAAATGCAAAATAAAAAAATTTTTAAATGAATTCCAAGAAATATG
AACAAATAGCTTTTAAATAAAATAATTTGTTAAGTAACTAATTTACTAATTAGAGCAAAT
TAAAAGAATAAATTAATTTTAATTAAACAATAAATAATAAATATCTTACTATGAAAGCAA
TTCAATTAATAAACATCTAATTTAAGACAATTAATTATTAAACAGAATCTTATTTTTAAG
AAAATTAATTATTAAGCATCTATTTTTTAAAGCAATTTATTAATAATCATCTAATTTTTA
AGACTGATAAATAAATAATCAAGATACATCTAATTTTGATTACAACTAATTAATAAATAA
CTAATTATTACAAAAAGTAAATCAATTTGGTATTTAACAATAAATATCTTATTATGAAAG
CAATTAATATCAAATTTTAATACAATTAATTATTAAACAGTATCATCTAATTTTTAAGGA
AATAAACATCTAATTTTTAAAGCAATAAAATAGCAAAATAATTTTTAATACTTTTAAAAA
TTCAACATCTAATTTTTAAAACAATAAATTAATTTTTAAATAAAATAATTAAAAAAATTA
TTTTTAAGGAATTATTTAATAAAGAGTATATTTTCAAAGCAATTAATTAAATACTTGTCT
AGTTTTTAAAGAAATTATCACTAAAAAATATTAATTCAAAATTAATTTTAGAATATTTAA
AAAAATATTTTTTCAACACTTTTAACATTTTAAACTTTGTTAAAATTAAAATTAATTTTT
TTTTGCAAAATAAAAATTTACTTAAAACAAATAATGAAATAAACTCTCTTTAATAAATTA
TAGCAAAAAATAATTTATTTTATTTTAAAATTTAATATGGAGATTGATATATTTTTTATT
TTAAAAATACATTTTATTTTTTAATAAATTGTTTTTAAAATTTAAATAAAATATTTAGCT
TGCCTGTTGTTCAACCTTATAGATCAAAGGGACAATTAGATGTGATTAACACTGTGATAC
AAAAAATAGCAGTAGAACAAGATTCAGATAGAGTAAATAAATAAAATTTAGATAATTTTA
ACAGTTATTAATGAGTTTTATTATAAATGTTATTAGCTACCCATAAATAAGTCAAAATAA
AGATCTGCCTTCCCTCCCAATTATATTCACTCTCTCGATTCTACTCACTTGATGTACACC
GCTTTAGAATGTATCAAACGGTATTACTTTAAATGATTAAATTATAATTCTACTTAGCTA
ATTTGTTATCATTTATCTATAAATAGTGGCATGCATTTTGCAGCTGTTCACGATTCTTAT
TGGACTCACGCCTGCGATATTGAAGAAATGCACAAAATTTTGAGAGAACAAGTAAAATAA
TCATATTTTTATCGAATTCTAATCAAATTTAATAAATAAATAGTTCGTTAAATTGCACAG
CCAACCTCTGCTTGAAGACTTAAAAGCATCCTTCGAAAGAAGATATCCAAACATAGAATT
CCCAGAGATTCCAAACAGAGTAAAAAAGCTTATTAAAGTGAGACAATAAATGGAAATTAA
TGATTATTTAAATAAATAAATTAATAGGGACTACTCGATTTAGAAGAAGTTAAAAAGAGT
ACTTATTTCTTTTGTTGA