Identifiers and Description

Gene Model Identifier

TTHERM_01119470

Standard Name

None

Aliases

PreTt14786 | 242.m00033

Description

translation initiation factor IF-2

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( TIGR02729 ) Obg family GTPase CgtA
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR01393 ) GTP-binding protein LepA
  • ( TIGR03156 ) GTP-binding protein HflX
  • ( PF03144 ) Elongation factor Tu domain 2
  • ( TIGR00101 ) urease accessory protein UreG
  • ( TIGR01394 ) GTP-binding protein TypA/BipA
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00485 ) translation elongation factor Tu
  • ( TIGR00487 ) translation initiation factor IF-2
  • ( TIGR00491 ) translation initiation factor aIF-2
  • ( PF00009 ) Elongation factor Tu GTP binding
  • ( TIGR02528 ) ethanolamine utilization protein, EutP
  • ( TIGR02034 ) sulfate adenylyltransferase, large subunit
  • ( TIGR00483 ) translation elongation factor EF-1, subunit
  • ( PF04760 ) Translation initiation factor IF-2, N-terminal
  • ( TIGR00475 ) selenocysteine-specific translation elongation factor

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01119470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20079.19.997093137033517e-262elongation factor Tu GTP bindi
ng domain-containing protein (
746 aa)
OxytrichaContig17818.0.g405.99747839515332e-98Elongation factor Tu GTP bindi
ng domain
SGDYOL023W4.001456298413176e-90IFM1 Mitochondrial translation
initiation factor 2
WormBaseWBGene000097712.0008312485874125e-83status:Partially_confirmed U
niProt:Q20447 protein_id:CAA
94822.2
DictyBaseDDB_G02757516.9972728945133496e-59DDB_G0275751 on chromosome: 2
position 5859705 to 5862840
Stentor CoeruleusSteCoe_82685.665668176358939e-52

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01119470(coding)
ATGTTAGGCAAGATATTTAAGCAAAAACTTTAATTTATTAAGTCGTCTCTAAAGATTCAT
CAAAATTCTAGACTTTCTTTGATACAAAATATATAATTTTAATCTCGAAGCCCATTTTGC
AGTTTAGAATAGCGTCCTTAAATATTGAAGAACTCTATTAAATTAGGAAATGACGCTTCG
AAGGGGTAGCAAATACAAAAGAATTTATAGGAGGAGTTTAATTAGATTGAGTTAATTTCA
AACCCATAGCACCAAAATAGGGTAAAGAAGATTATTCAAACTTATGTTGTCAATACAGAT
TTTGTTAACATAGAACAATTGGCTGAATTTATTGCTTTTGATGGTTAAAAATTACTCTAA
AAGTTAACATCAATGGGCATAAATCCTGAAAAAATTAGTTTAAAGGAGGCAAATCTGATA
TCTTTAGAATATGATGTAAAGATATAGCATAAGAACGAAAAGGGGAACATAAAGCAAAGA
TCGCCTGTTGTTACCATTATGGGTCACGTCGATCATGGCAAAACAACATTGTTAGATTAT
TTAAGAAATAGTTAAATTGCTAAAGGTGAATTTGGAGGTATAACTCAAAAAATTGGTGCA
TTTCACGTTTTAACTCCTGAAGGGTAAAGAATAACTTTTATTGATACTCCAGGTCACGAG
GCTTTTTCAAATATGAGAGTGCGTGGAGCTAATTCAACAGATATGATTATTTTGGTTGTA
TCTGCTATTGAAGGAATATAGCCTTAGACACTAGAAGTTATTAAGTTAGCTCATTAGAAT
CAAGTTCATATCTTAGTTGCAATAAATAAAATTGATGTTCCAGGAGCACGTCCTGATTTA
GTTGAAAAGTAATTAAAGGAGTAAGGGAAATTAGATTTAGAGCCATTTGGAGGTAACATT
CCAGTTGTTCATATTTCTGCTTTAAATGGCACAAACATGGACTTGCTGTTGGAATTAATT
TTATTCGAATCAGAACTCATGGAATTGAAAGAAGATTACGATTCTTTAGCTGAAGGAGTT
GTGATTGAAAGCAGAAGAGATGTTGACAATGATGAAAAAAGTTGCACAATTATTGTCTAA
AAAGGCACATTAAAGGTTGGTGATCATATTATTATTGGAAATAACTATTGCAAAGTGAGA
TCAATAAAAGATGATAAAAAAAATATGCTTAAGCAGGCTTTTCCTTCATATGCAGTTGAA
ATTACTGGAATTAAAGAATTGCCTTAATCTGGAGACGTAGTTTTTGCTTTAGAGTCAGAA
AACAAAGCTAAAGTGATCTCCCAAAGAAGAATTAAAAATGAAGAAGAACTCAATAGCCAA
GAAGAACAATTCATTTAAGGATCAGGATCTAAGTTGAAATTTGAAAATGTCAGAGAAAAA
AGAAAATTCTTCTCTGGAAACAGAGAAATCACAGAAGCTAAATATAACGAAGTAGAGGCA
AGAATTTTAGACAAAATAAAACAATTGGAAGAAATAGATTTTAAGTCAGAAACAGAGATG
AATGATATTTAATAAAAAATATAAAAATTAAAATAAGATTTGTAATAGAATAAGTAGTAT
ATGGCTAATTTAGTAGGAGATGTTAAAGTAGGAAATAGTATTAATTTAATTATAAAGGCA
AACGATTTTGGTACAAAAGAAACTTTGGTGTCTTAAATTATCAAGGCTAAGTTAGCATAC
GAAGATATTCAATTAAATATAATTAGCGCTACTGTTGGTTAGGTTACAGAAGCTGATATT
AGAGACGCTGAATTATTTAATGCTAAGATATTGGGTATGGATATCTAACTCTCTAAGGAT
GTAGAGTAATTAGTTAAATAAAAGAAAATTGTAGTTAAATCTCACAAAATTATTTACACC
TTAATTGATGATATTAAATTGCTGATGGAACAAGGTCCAGAAGAGGCTGAAGAAGAAGAA
AAAGAAGTAGAAAGAGGTCAAGCTGTAATCCAATCAGTTATTGAAATCAAAGCATCTAAA
TCATAAACACAATTCGTTGCTGGATGCAAAGTTTTAAGCGGTAAAATAAATAAGAAACAT
TTATATAGAATTGAAAGAGATGGCGAAATCATTGAAAAAGATTTAGAAATTGCTAATCTC
AGACACTTTAAGAAAGAAGTAGAAGAAATCAAAGAAGGCAGCGAATGCGGAATAATCTTC
TTTAGATTTAATTCTTTCGAAGAAGGAGATACTGTCGTAGCCTATGAAAAAGAGTGA


>TTHERM_01119470(protein)
MLGKIFKQKLQFIKSSLKIHQNSRLSLIQNIQFQSRSPFCSLEQRPQILKNSIKLGNDAS
KGQQIQKNLQEEFNQIELISNPQHQNRVKKIIQTYVVNTDFVNIEQLAEFIAFDGQKLLQ
KLTSMGINPEKISLKEANLISLEYDVKIQHKNEKGNIKQRSPVVTIMGHVDHGKTTLLDY
LRNSQIAKGEFGGITQKIGAFHVLTPEGQRITFIDTPGHEAFSNMRVRGANSTDMIILVV
SAIEGIQPQTLEVIKLAHQNQVHILVAINKIDVPGARPDLVEKQLKEQGKLDLEPFGGNI
PVVHISALNGTNMDLLLELILFESELMELKEDYDSLAEGVVIESRRDVDNDEKSCTIIVQ
KGTLKVGDHIIIGNNYCKVRSIKDDKKNMLKQAFPSYAVEITGIKELPQSGDVVFALESE
NKAKVISQRRIKNEEELNSQEEQFIQGSGSKLKFENVREKRKFFSGNREITEAKYNEVEA
RILDKIKQLEEIDFKSETEMNDIQQKIQKLKQDLQQNKQYMANLVGDVKVGNSINLIIKA
NDFGTKETLVSQIIKAKLAYEDIQLNIISATVGQVTEADIRDAELFNAKILGMDIQLSKD
VEQLVKQKKIVVKSHKIIYTLIDDIKLLMEQGPEEAEEEEKEVERGQAVIQSVIEIKASK
SQTQFVAGCKVLSGKINKKHLYRIERDGEIIEKDLEIANLRHFKKEVEEIKEGSECGIIF
FRFNSFEEGDTVVAYEKE


>TTHERM_01119470(gene)
ATGTTAGGCAAGATATTTAAGCAAAAACTTTAATTTATTAAGTCGTCTCTAAAGATTCAT
CAAAATTCTAGACTTTCTTTGATACAAAATATATAATTTTAATCTCGAAGCCCATTTTGC
AGTTTAGAATAGCGTCCTTAAATATTGAAGAACTCTATTAAATTAGGAAATGACGCTTCG
AAGGGGTAGCAAATACAAAAGAATTTATAGGAGGAGTTTAATTAGATTGAGTTAATTTCA
AACCCATAGCACCAAAATAGGGTAAAGAAGATTATTCAAACTTATGTTGTCAATACAGAT
TTTGTTAACATAGAACAATTGGCTGAATTTATTGCTTTTGATGGTTAAAAATTACTCTAA
AAGTTAACATCAATGGGCATAAATCCTGAAAAAATTAGTTTAAAGGAGGCAAATCTGATA
TCTTTAGAATATGATGTAAAGATATAGCATAAGAACGAAAAGGGGAACATAAAGCAAAGA
TCGCCTGTTGTTACCATTATGGGTCACGTCGATCATGGCAAAACAACATTGTTAGATTAT
TTAAGAAATAGTTAAATTGCTAAAGGTGAATTTGGAGGTATAACTCAAAAAATTGGTGCA
TTTCACGTTTTAACTCCTGAAGGGTAAAGAATAACTTTTATTGATACTCCAGGTCACGAG
GCTTTTTCAAATATGAGAGTGCGTGGAGCTAATTCAACAGATATGATTATTTTGGTTGTA
TCTGCTATTGAAGGAATATAGCCTTAGGTATATTTTTTGTTTTATATTGAATGTGTAAAT
AATAATTTTAATCAACAATTTCTGATAAAAAAGACACTAGAAGTTATTAAGTTAGCTCAT
TAGAATCAAGTTCATATCTTAGTTGCAATAAATAAAATTGATGTTCCAGGAGCACGTCCT
GATTTAGTTGAAAAGTAATTAAAGGAGTAAGGGAAATTAGATTTAGAGCCATTTGGAGGT
AACATTCCAGTTGTTCATATTTCTGCTTTAAATGGCACAAACATGGACTTGCTGTTGGAA
TTAATTTTATTCGAATCAGAACTCATGGAATTGAAAGAAGTAAAAAATATTAAGGAATTT
AAATAGAATTTAATGGAAAATTTAATATAGGATTACGATTCTTTAGCTGAAGGAGTTGTG
ATTGAAAGCAGAAGAGATGTTGACAATGATGAAAAAAGTTGCACAATTATTGTCTAAAAA
GGCACATTAAAGGTTGGTGATCATATTATTATTGGAAATAACTATTGCAAAGTGAGATCA
ATAAAAGATGATAAAAAAAATATGCTTAAGCAGGCTTTTCCTTCATATGCAGTTGAAATT
GTAATATTTTTATATTGAATTTAGATTCAATTTAATATTAAAAATAAACAAAAAAAATAA
GACTGGAATTAAAGAATTGCCTTAATCTGGAGACGTAGTTTTTGCTTTAGAGTCAGAAAA
CAAAGCTAAAGTGATCTCCCAAAGAAGAATTAAAAATGAAGAAGAACTCAATAGCCAAGA
AGAACAATTCATTTAAGGATCAGGATCTAAGTTGAAATTTGAGTAAAATTAATTATTTTT
GTATTAATATTTTAAAAGAATTATTTTATTAATTAATTTAAAGAAATGTCAGAGAAAAAA
GAAAATTCTTCTCTGGAAACAGAGAAATCACAGAAGCTAAATATAACGAAGTAGAGGCAA
GAATTTTAGACGTAATTCTAACGATTAGAATAAAAATTTAATGAAATTTAATTATAATAA
TAAATGAATAAAAGAAAATAAAACAATTGGAAGAAATAGATTTTAAGTCAGAAACAGAGA
TGAATGATATTTAATAAAAAATATAAAAATTAAAATAAGATTTGTAATAGAATAAGTAGT
ATATGGCTAATTTAGTAGGAGATGTTAAAGTAGGAAATAGTATTAATTTAATTATAAAGG
CAAACGATTTTGGTACAAAAGAAACTTTGGTGTCTTAAATTATCAAGGCTAAGTTAGCAT
ACGAAGATATTCAATTAAATATAATTAGCGCTACTGTTGGTTAGGTTACAGAAGCTGATA
TTAGAGACGCTGAATTATTTAATGCTAAGATATTGGGTATGGATATCTAACTCTCTAAGG
ATGTAGAGTAATTAGTTAAATAAAAGAAAATTGTAGTTAAATCTCACAAAATTATTTACA
CCTTAATTGATGATATTAAATTGCTGATGGAACAAGGTCCAGAAGAGGCTGAAGAAGAAG
AAAAAGAAGTAGAAAGAGGTCAAGCTGTAATCCAATCAGTTATTGAAATCAAAGCATCTA
AATCATGTAAATATAAAGATTTCATCTAAAGATTATTTAGTTATTTTAATATTATCAAAA
GAAACACAATTCGTTGCTGGATGCAAAGTTTTAAGCGGTAAAATAAATAAGAAACATTTA
TATAGAATTGAAAGAGATGGCGAAATCATTGAAAAAGATTTAGAAATTGCTAATCTCAGA
CACTTTAAGAAAGAAGTAGAAGAAATCAAAGAAGGCAGCGAATGCGGAATAATCTTCTTT
AGATTTAATTCTTTCGAAGAAGGAGATACTGTCGTAGCCTATGAAAAAGAGTGA