Identifiers and Description

Gene Model Identifier

TTHERM_01108510

Standard Name

None

Aliases

PreTt20382 | 238.m00032 | 3797.m00191

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_01108510

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18886.19.997093137033517e-262hypothetical protein (679 aa)
OxytrichaContig13360.0.g121.9992362000979228e-56Galactose oxidase, central dom
ain
Stentor CoeruleusSteCoe_111622.6102790696677047e-23
DictyBaseDDB_G02688607.003160085026828e-16rngB on chromosome: 1 position
2266964 to 2269912
SGDYHR158C0.000000100009565553302KEL1 Protein required for prop
er cell fusion and cell morpho
logy; functions in a complex w
ith Kel2p to negatively regula
te mitotic exit, interacts wit
h Tem1p and Lte1p; localizes t
o regions of polarized growth;
potential Cdc28p substrate
WormBaseWBGene000018270.000005000363240844623locus:hcf-1 status:Confirmed
UniProt:G5EC23 protein_id
:CCD66593.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01108510(coding)
ATGAAGAATTTATTTTATAAAAAAGTCTAATATAGCAAAACCAACGAAGTTCCTCGCATA
GAAGAGGGCGTTTCGCTGGATTATTTAATTGATAGAAATAAATATATTTATTTTGGAGGT
GTTAAACCGAAAGAAGTTACAAAAGATACCAAACTATTTTAGAATGATAAAGATAAAAAT
GAAGTTAAAACAGCAAACACTATCAATTTAGGTTAGGGAAAAAACGCCCCTACAATTAAT
ACAACAAATAGCATTTAATTTAAAATTGCGGAACTTGATAATCCATTTACATTAAATCCT
GCTTTATAAAATAATACAATCCACTACTTCGATCCAATTAATTAGGATTGGACAGAATAT
GAATGTACTGGAAAAATTCCATCAAAGAGAATTTATCATTAGAGTTGGTACTAATCTCCC
TATTTGTTTATTTATGGAGGTCTTTCTCCTGAAAAAAAAATATTGAATGACATGTATGTG
CTTAATTGTGATACAAGAGTTTGGAATTCTTTCTTTTGGTATAATGGACCTAATCCTCCA
AAAATATACTCTCAGCTTGTAAATATGGGTGATAGAAAATTTGTGATAGGAGGTGCATCT
ATGCCAGAAAATCTACTTACTAATGAAGTGTGGTCTTTTTCATTAGATAACATGGAATGG
GATTCTGGTTTCGATGATTACAAACCTATTAAGTGGGAAAAAATAGATTTTTAAGATCAT
CACTTGTTTCCACCAACTAAAGCTCATAGTGCCATTAAAATATCTTAAAATTAAATATTC
ATATTTGGTGGGTTTAACTAAAAAAAGTAGTGCACAGATACATCAATCATTATGGATATT
GAAAAAAGGAGAATTTTCCACTTTGAAACTAGAGGTCAAAAACCTTGTCCAAGAGCCTTC
CATAAAATGCTTCCTGTTAAAGAAAATATTATCTGCTTGTTTGGAGGTATAAGCTGTCCA
GAAGATGCCATTAAAAGCTTGACAGCTACTTATCTGAATGATTTTTATTTATTAAATTTA
AACGAAGGCTATTGGTCAAGACCTAATTGTGGAGGTTATGTGCCAACTCCTAGATATTCA
TTTGCTATGGCATCTAACCAAAGCGAGTAACAAGGGGAAATTATAATTTTAGGAGGAAGA
ACTTTAGAAAGTATAGGTGACAAGCAAGTATACATTTTGTGTGAACTAGAGTCAAATAGT
GAAGAAGCCTATGGAATAATAGATCACGAAGCTAAATTACAATATGATGAATTCAGAGAA
GCAAATAAAAAAGATAAAAATAAAGAAAAAGAATTAAAAAATGTCTCGATGGTTACTCTC
GAATTCAGCTAGGCAGAAAAATACATCGTTGAGCAAAAGAGAAAAATAGGAGAATTAGAA
ACAGTCTATAAAAAACTAAAAGATTCTAACAAATAAACATTAGAAAATCATAAAATATAC
TCTGATAAAATTTTATAGCTAGGTTAAGAACTTGAAGACCAATCAATAAAGCTTACAAAA
GAAATTTAAAGTAAAACTAGTCGTAATTAATAAAGTGCTTAATTGCTCACCAAAGTTAAA
ATGATTCTTGCTCAAGAAAGAAAAAAAAGAAAATTACTTGAGTTAAAATCCCATGCTTTG
CAAGATACATTTAAAAAGGCAGAATCCTTTGTTGTCACACTCGATACAATTTACACAAGA
GGCTAAAAAGACAACTTGTTCCAAGGATTAGTTGGCAATGATGTTCTTGAAAAAATTGAG
AAGCAAAGAGAAGAGCATAAAAATTAAATGTAAGACTTTAAATAAGATTTTGAAATAGGA
ATAAGTAGAGAAGAACGTATAAAGAAAAATATGAAATAAAAGAAAGAAAGCATCAAATAG
TTCTACAACGTATCTCAAGAGTGGAAAAAGCTTCTCACTAGTGACGAAAAATTGCTTTTC
CCTTAAAAGATACCTACTAATTAAAACATTCCTAAGCAGTGA


>TTHERM_01108510(protein)
MKNLFYKKVQYSKTNEVPRIEEGVSLDYLIDRNKYIYFGGVKPKEVTKDTKLFQNDKDKN
EVKTANTINLGQGKNAPTINTTNSIQFKIAELDNPFTLNPALQNNTIHYFDPINQDWTEY
ECTGKIPSKRIYHQSWYQSPYLFIYGGLSPEKKILNDMYVLNCDTRVWNSFFWYNGPNPP
KIYSQLVNMGDRKFVIGGASMPENLLTNEVWSFSLDNMEWDSGFDDYKPIKWEKIDFQDH
HLFPPTKAHSAIKISQNQIFIFGGFNQKKQCTDTSIIMDIEKRRIFHFETRGQKPCPRAF
HKMLPVKENIICLFGGISCPEDAIKSLTATYLNDFYLLNLNEGYWSRPNCGGYVPTPRYS
FAMASNQSEQQGEIIILGGRTLESIGDKQVYILCELESNSEEAYGIIDHEAKLQYDEFRE
ANKKDKNKEKELKNVSMVTLEFSQAEKYIVEQKRKIGELETVYKKLKDSNKQTLENHKIY
SDKILQLGQELEDQSIKLTKEIQSKTSRNQQSAQLLTKVKMILAQERKKRKLLELKSHAL
QDTFKKAESFVVTLDTIYTRGQKDNLFQGLVGNDVLEKIEKQREEHKNQMQDFKQDFEIG
ISREERIKKNMKQKKESIKQFYNVSQEWKKLLTSDEKLLFPQKIPTNQNIPKQ


>TTHERM_01108510(gene)
ATGAAGAATTTATTTTATAAAAAAGTCTAATATAGCAAAACCAACGAAGTTCCTCGCATA
GAAGAGGGCGTTTCGCTGGATTATTTAATTGATAGAAATAAATATATTTATTTTGGAGGT
GTTAAACCGAAAGAAGTTACAAAAGATACCAAACTATTTTGTAAAATATAACACAATTAC
ATTCATTTATATTGATATTCAGATATTATAATTAGAGAATGATAAAGATAAAAATGAAGT
TAAAACAGCAAACACTATCAATTTAGGTTAGGGAAAAAACGCCCCTACAATTAATACAAC
AAATAGCATTTAATTTAAAATTGCGGAACTTGATAATCCATTTACATTAAATCCTGCTTT
ATAAAATAATACAATCCACTACTTCGATCCAAGTACGTACATACATACATATTTAATTAA
AATTTTAATATGATTGATTGAGTATAAAATTTACAGTTAATTAGGATTGGACAGAATATG
AATGTACTGGAAAAATTCCATCAAAGAGAATTTATCATTAGAGTTGGTACTAATCTCCCT
ATTTGTTTATTTATGGAGGTCTTTCTCCTGAAAAAAAAATATTGAATGACATGTATGTGC
TTAATTGTGATACAAGAGTTTGGAATTCTTTCTTTTGGTATAATGGTAATTTTTTGCTGA
TTGAAATATATTTGTAATACACCTAATTTATAAATTTAAATAGGACCTAATCCTCCAAAA
ATATACTCTCAGCTTGTAAATATGGGTGATAGAAAATTTGTGATAGGAGGTGCATCTATG
CCAGAAAATCTACTTACTAATGAAGTGTGGTCTTTTTCATTAGATAACATGGAATGGGAT
TCTGGTTTCGATGATTACAAACCTATTAAGTGGGAAAAAATAGATTTTTAAGTAGGATAT
TTTATATTAATTTGTATTTGAAATTATAAATTATTTATATTATTAGGATCATCACTTGTT
TCCACCAACTAAAGCTCATAGTGCCATTAAAATATCTTAAAATTAAATATTCATATTTGG
TGGGTTTAACTAAAAAAAGTAGTGCACAGATACATCAATCATTATGGATATTGAAAAAAG
GAGAATTTTCCACTTTGAAACTAGAGGTCAAAAACCTTGTCCAAGAGCCTTCCATGTACT
CTTAATTTATTAATTAATTAAGAATAATAAACAGTTATTATTTTTTAAAGAAAATGCTTC
CTGTTAAAGAAAATATTATCTGCTTGTTTGGAGGTATAAGCTGTCCAGAAGATGCCATTA
AAAGCTTGACAGCTACTTATCTGAATGATTTTTATTTATTAAATTTAAGTAATTTTAATT
CAAAAACTAATGATTTATCTATGATAATCAATAAATTTTTTAGACGAAGGCTATTGGTCA
AGACCTAATTGTGGAGGTTATGTGCCAACTCCTAGATATTCATTTGCTATGGCATCTAAC
CAAAGCGAGTAACAAGGGGAAATTATAATTTTAGGAGGAAGAACTTTAGAAAGTATAGGT
GACAAGCAAGTATACATTTTGTGTGAACTAGAGTCAAATAGTGAAGAAGCCTATGGAATA
ATAGATCACGAAGCTAAATTACAATATGATGAATTCAGAGAAGCAAATAAAAAAGATAAA
AATAAAGAAAAAGAATTAAAAAATGTCTCGATGGTTACTCTCGAATTCAGCTAGGCAGAA
AAATACATCGTTGAGCAAAAGAGAAAAATAGGAGAATTAGAAACAGTCTATAAAAAACTA
AAAGATTCTAACAAATAAACATTAGAAAATCATAAAATATACTCTGATAAAATTTTATAG
CTAGGTTAAGAACTTGAAGACCAATCAATAAAGCTTACAAAAGAAATTTAAAGTAAAACT
AGTCGTAATTAATAAAGTGCTTAATTGCTCACCAAAGTTAAAATGATTCTTGCTCAAGAA
AGAAAAAAAAGAAAATTACTTGAGTTAAAATCCCATGCTTTGCAAGATACATTTAAAAAG
GCAGAATCCTTTGTTGTCACACTCGATACAATTTACACAAGAGGCTAAAAAGGTACATTT
TTATCTATTTAAGAATTTTATTTTAGAATTTATAAGTTTAGTAAAAATTTTTTATTCGAA
GAGCTATTTTTTTAGGAAATTCAATTAGAAAAACTATAAAAGAAATAATTATTTCCATAA
ATTCCAATAATCCTCTAAATAAATTTTAGTATCTAAAAAAACATTTTTGCATTTTATAGT
TAAAAGCTTTAATATTCTTTTTAATAAGTAATAATTTTTTATGAAAAGAAATCATTTAAA
TTTTAGTAAAATAATTTCATTAATAAAAAAAGTTTATTTTAATTTTAATATTTTTAAAAG
AATTAATTAATATTTTTTAAATTAATTTTATTTGCAATAAATAGACAACTTGTTCCAAGG
ATTAGTTGGCAATGATGTTCTTGAAAAAATTGAGAAGCAAAGAGAAGAGCATAAAAATTA
AATGTAAGACTTTAAATAAGATTTTGAAATAGGAATAAGTAGAGAAGAACGTATAAAGAA
AAATATGAAATAAAAGGTAAAATAATTTTTTTATTTTATATTTTAATATATATAAATAAG
TTAATTTATTTGATATATGGTAGTTTAATTAGCTAATTGAAATATATTTTATTAAATAAT
TCAGAAAGAAAGCATCAAATAGTTCTACAACGTATCTCAAGAGTGGAAAAAGCTTCTCAC
TAGTGACGAAAAATTGCTTTTCCCTTAAAAGATACCTACTAATTAAAACATTCCTAAGCA
GTGA