Identifiers and Description

Gene Model Identifier

TTHERM_01104920

Standard Name

None

Aliases

PreTt01884 | 235.m00035

Description

GTP1/OBG family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_01104920

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16524.19.997093137033517e-262GTP1/OBG family protein (368 a
a)
DictyBaseDDB_G02893171.9991691033935208e-179drg1 on chromosome: 5 position
2634493 to 2636111
OxytrichaContig6883.0.g742.0009778678102968e-172TGS domain
WormBaseWBGene000121263.000071119766155e-172status:Confirmed UniProt:G5E
GL2 protein_id:CAB57908.1
SGDYAL036C1.9990846765523993e-155RBG1 Member of the DRG family
of GTP-binding proteins; assoc
iates with translating ribosom
es; interacts with Tma46p, Ygr
250cp, Gir2p and Yap1p via two
-hybrid
Stentor CoeruleusSteCoe_373133.665820411179563e-77

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01104920(coding)
ATGACAACAGCATAGAAAATAGCTGAAGTTGAGCTAGAAATGGAACGTACCCAAAAGAAT
AAGGCTACTTCCTATCACTTGGGTCAATTAAAAGCAAAATTAGCAAAATTAAAAAGAGAA
TTGATTGAAGGTGGTAAAGGTAAATCAGGTCCTGTAGGAGAAGGTTTCGATGTCTCAAAG
AGTGGTGATGCTCGTGTTGGTATGATCGGTTTCCCCTCTGTCGGTAAATCTACCCTTTTA
ACAAAGCTAACTGGTACTGAATCCAAGATTGCTGCTTATGAATTCACAACATTAACTTGT
ATTCCAGGTAATGTCTTCTACAAGGGATCTAAAATTTAATTGCTCGATTTACCTGGTATT
ATCGAAGGTGCCAAGGATGGTAAAGGTCGTGGTAAATAGGTCATTGCTGTTGCCAGAACT
TGTAATTTGATTTGCATAGTTTTAGACGCAACAAAGCCTATGAAACATAAAAAGATTATT
GAAGGTGAATTGGAAGGTTTCGGTATTAGATTAAACAAACAACCTCCTAAAGTTGATTTC
AAAATTAAGCCAAAAGGTGGTATTAATATTACTCACATGGTTGAAAATCCTGACCTTGAT
GATGAAATGATTAAGACCATTTTAAAGGAATATAGAATTAACTCTGTCGATATTGTTTTT
AGAGAAAAGATTAATGAAGATTAATTAATTGATATTATTGAAGGTAATAGAAAATATATT
CCATGCCTTTATGTTATGAATAAAATTGATGACCTTACAATGGAAGAATTAGATATTATT
GACTAAATTCCTCATTATGTTCCCATCTCTGCTCACTTGGAATGGAACCTTGATGAATTA
ATAGAACGTATGTGGGAATACTTAGATCTCTATCGTGTATACACTAAACCTAAGGGCAAA
GCTCCTGATTATGAAAAGCCTGTTATCTTGCCCAGAAAGAAATCTACAGTTGAAGATTTT
TGTATGAGAATTCATAGAACTATGATTAATGATATGAAATATGCATTAGTTTGGGGTACT
TCTGTCAAGCACAATCCTCAAGTATGTGGTAAAGACCATCAACTTAATGATGAAGATATC
GTTCAAATTATCAAAAAGATTTGA


>TTHERM_01104920(protein)
MTTAQKIAEVELEMERTQKNKATSYHLGQLKAKLAKLKRELIEGGKGKSGPVGEGFDVSK
SGDARVGMIGFPSVGKSTLLTKLTGTESKIAAYEFTTLTCIPGNVFYKGSKIQLLDLPGI
IEGAKDGKGRGKQVIAVARTCNLICIVLDATKPMKHKKIIEGELEGFGIRLNKQPPKVDF
KIKPKGGINITHMVENPDLDDEMIKTILKEYRINSVDIVFREKINEDQLIDIIEGNRKYI
PCLYVMNKIDDLTMEELDIIDQIPHYVPISAHLEWNLDELIERMWEYLDLYRVYTKPKGK
APDYEKPVILPRKKSTVEDFCMRIHRTMINDMKYALVWGTSVKHNPQVCGKDHQLNDEDI
VQIIKKI


>TTHERM_01104920(gene)
ATGACAACAGCATAGAAAATAGCTGAAGTTGAGCTAGAAATGGAACGTACCCAAAAGAAT
AAGGCTACTTCCTATCACTTGGGTCAATTAAAAGCAAAATTAGCAAAATTAAAAAGAGAA
TTGATTGAAGGTGGTAAAGGTAAATCAGGTCCTGTAGGAGAAGGTTTCGATGTCTCAAAG
AGTGGTGATGCTCGTGTTGGTATGATCGGTTTCCCCTCTGTCGGTAAATCTACCCTTTTA
ACAAAGCTAACTGGTACTGAATCCAAGATTGCTGCTTATGAATTCACAACATTAACTTGT
ATTCCAGGTAATGTCTTCTACAAGGGATCTAAAATTTAATTGCTCGATTTACCTGGTATT
ATCGAAGGTGCCAAGGATGGTAAAGGTCGTGGTAAATAGGTAAAAAATATACATAATAAA
ATATTTTCAATTATTAGATTACAAAATAGTTGTATTTAGATCAGAAGATTTTTAATATTT
TAGCTTATAATTTTTACAAATTTGATCATTTAAATAGAAATCTTTCAAAAAAAAATGAGT
AAAAAATGTGTTTAAGCTAGTTTTTTTTAAGTTAAAAGCAATTAGTCGTCAATAGCAATA
AATAGATTTAATTTATTAATAGATTAATTTATCACTTTTTTTATATTTAAGTTAATATTT
GTATTAAAAAGGTCATTGCTGTTGCCAGAACTTGTAATTTGATTTGCATAGTTTTAGACG
CAACAAAGCCTATGAAACATAAAAAGATTATTGAAGGTGAATTGGAAGGTTTCGGTATTA
GATTAAACAAACAACCTCCTAAAGTTGATTTCAAAATTAAGCCAAAAGGTGGTATTAATA
TTACTCACATGGTTGAAAATCCTGACCTTGATGATGAAATGATTAAGACCATTTTAAAGG
AATATAGAATTAACTCTGTCGATATTGTTTTTAGAGAAAAGATTAATGAAGATTAATTAA
TTGATATTATTGAAGGTAATAGAAAATATATTCCATGCCTTTATGTTATGAATAAAATTG
ATGACCTTACAATGGAAGAATTAGATATTATTGACTAAATTCCTCATTATGTTCCCATCT
CTGCTCACTTGGAATGGAACCTTGATGAATTAATAGAACGTATGTGGGAATACTTAGATC
TCTATCGTGTATACACTAAACCTAAGGGCAAAGCTCCTGGTATTTAATTAATTTATATTT
AAAAATACTTAACCAACTATAAAAACATTTAATTAATTATATAGATTATGAAAAGCCTGT
TATCTTGCCCAGAAAGAAATCTACAGTTGAAGATTTTTGTATGAGAATTCATAGAACTAT
GATTAATGATATGAAATATGCATTAGTTTGGGGTACTTCTGTCAAGCACAATCCTCAAGT
ATGTGGTAAAGACCATCAACTTAATGATGAAGATATCGTTCAAATTATCAAAAAGATTTG
A