Identifiers and Description

Gene Model Identifier

TTHERM_01054220

Standard Name

None

Aliases

PreTt19816 | 214.m00043

Description

50S ribosomal protein L1P; L1P family of ribosomal proteins containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( TIGR01169 ) ribosomal protein L1
  • ( PF00687 ) L1P family of ribosomal proteins
  • ( PF06435 ) Repeat of unknown function (DUF1079)
  • ( TIGR01170 ) ribosomal protein L1, mitochondrial

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15.1%

TetraMine Data

TTHERM_01054220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17142.19.997093137033517e-262L1P family-ribosomal protein c
ontaining protein (274 aa)
OxytrichaContig17599.0.g529.997652352281279e-57Ribosomal protein L1p/L10e fam
ily
Stentor CoeruleusSteCoe_126781.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01054220(coding)
ATGATCGGATTAAGATAACTTAGCTAAGCACTTCATGTCACCCAATATTTAACCATGGTT
AATAAGAACATGGCCAATTTCGCAAAATTAAAAAGAAGAACAAAAAAACCTAAAAAAGAA
GATGAAAACAATCCTATTTATAATATATTCTAAGCTCTTAAATTAGTTAGATGCCATTCT
ATTGCTCCCTACCCAGAAACTATTGATTTTAGCGTTATTTTGAATGTTGATCCTCGTCAC
GGTGACCAAATCGTTAGAGGTTCTGCTAAGATGCCTGCAGGTTTGGGAAAATCTAAAAAG
CTTTGCGTTTTCGCATCTGAATCATTAAAGCAATAAGTTCTTGATGCAGGCGCCGATATT
TTTGGTGACGAAGAAGTTCTTAAAAATATTAAGAATGGTGTCATTGATTTCGAATAAATT
ATAGCTACTTCTGATGCCATGGTTAAACTTAAAGCTTATGCTAGAACTTTAGGTCCTAAG
GGTCTTATGCCTAACTAAAAGATTGGTAATCTTGTCAGTGATGAAAAATTAGTTTAAGCT
ATTGTAGATGCTAAGTAAGGTTAAGTCTAATTCAGAGTTGACCCTGGTAGCAACATTCAC
TCTCCCTTGGGTAAGGTGAGCTATAGTGACGAATAGATTCTTACGAATCTTAAATCTCTA
ATGTAAACTTTAGTTGAAAAGAAGCCTGCTGTTGTAAAATCAAATTATTTCGTTGACGCT
TATGTAAAATGTACTAAAGGTCCTAGCTTTAGAGTTTAAATAGATAACATTGATCCTAGA
AATAAAGCCTCACTTATAAATACTTTCAATTAACAATAATGA


>TTHERM_01054220(protein)
MIGLRQLSQALHVTQYLTMVNKNMANFAKLKRRTKKPKKEDENNPIYNIFQALKLVRCHS
IAPYPETIDFSVILNVDPRHGDQIVRGSAKMPAGLGKSKKLCVFASESLKQQVLDAGADI
FGDEEVLKNIKNGVIDFEQIIATSDAMVKLKAYARTLGPKGLMPNQKIGNLVSDEKLVQA
IVDAKQGQVQFRVDPGSNIHSPLGKVSYSDEQILTNLKSLMQTLVEKKPAVVKSNYFVDA
YVKCTKGPSFRVQIDNIDPRNKASLINTFNQQQ


>TTHERM_01054220(gene)
ATGATCGGATTAAGATAACTTAGCTAAGCACTTCATGTCACCCAATATTTAACCATGGTT
AATAAGAACATGGCCAATTTCGCAAAATTAAAAAGAAGAACAAAAAAACCTAAAAAAGAA
GATGAAAACAATCCTATTTATAATATATTCTAAGCTCTTAAATTAGTTAGATGCCATTCT
ATTGCTCCCTACCCAGAAACTATTGATTTTAGCGTTATGTAAACTCCATTTTGCATATTG
ATGAAATTTTGAGCTCTAGGAGACTCTCAGTTTCATTTAATTTACATCATTTCTTAATCA
TTTCTAAATATTAGTTTGAATGTTGATCCTCGTCACGGTGACCAAATCGTTAGAGGTTCT
GCTAAGATGCCTGCAGGTTTGGGAAAATCTAAAAAGCTTTGCGTTTTCGCATCTGAATCA
TTAAAGCAATAAGTTCTTGATGCAGGCGCCGATATTTTTGGTGACGAAGAAGTTCTTAAA
AATGTAATTTTTAGCATTTTGATTTCTCCTAATTAATTAGAAAGCATTCACTTATAAATG
AGGATAAAAGCATTTAATTGCTCTTAAGCAATATTAAGTTTTGAGTTGAATATTAAAAAT
ATAAACTAATTAAATGTGCATGCAAATAAATACAGCTTGCTTAATAATGATTGATCCTTA
AATATTGATAGTTATTAAATGAGATATATTATTTATTAGCTTTAATAACTCTATGCTTTG
ATAGCATAATTTACTCATATATATTTTTACATCATTTGTAAATGAACAAACAAGTGTTAT
AAAATTTAATTTTAACAATAGATTAAGAATGGTGTCATTGATTTCGAATAAATTATAGCT
ACTTCTGATGCCATGGTTAAACTTAAAGCTTATGCTAGAACTTTAGGTTTGTTTTCATTT
AAATTTAAATAAATTGCAAACTCAAATTTATTCTTTTTATTAATCAGGTCCTAAGGGTCT
TATGCCTAACTAAAAGATTGGTAATCTTGTCAGTGATGAAAAATTAGGTAATATAAATAA
TTAATATAATAAAATGGAATATCAAACTTAATAATTATTTTTAAAAAATTTAGTTTAAGC
TATTGTAGATGCTAAGTAAGGTTAAGTCTAATTCAGGTAATAATTTTTTAATTTTATAAT
CACATAAATCGTACAACAAATACTCAGCAAATATTCATTTATAGCAGGATTAAATACACC
ATAATTTTACATAAGTTGAAAGCTCTTATACTCAAAAAATATTTATATCATTTACAATTT
AGAATGATAGTTTGAATTGAAATGTAAAAAGAGTTTTAGTTGTATGAAAATAAGGAATTA
AATTATATAAATATATTTTTTTTAATAATTTTTATATTATCAAATAAAAAAAGAGTTGAC
CCTGGTAGCAACATTCACTCTCCCTTGGGTAAGGTGAGCTATAGTGACGAATAGATTCTT
ACGAATCTTAAATCTCTAATGTAAACTTTAGTTGAAAAGAAGCCTGCTGTTGTAAAATCA
AATTATTTCGTTGACGCTTATGTAAAATGTACTAAAGGTCCTAGCTTTAGAGTTTAAATA
GATAACATTGATCCTAGAAATAAAGCCTCACTTATAAATACTTTCAATTAACAATAATGA