Identifiers and Description

Gene Model Identifier

TTHERM_01050360

Standard Name

None

Aliases

PreTt27779 | 212.m00037

Description

Nucleotidyltransferase domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF03828 ) PAP/25A associated domain
  • ( PF01909 ) Nucleotidyltransferase domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01050360

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01476.19.996373193201036e-79hypothetical protein (689 aa)
DictyBaseDDB_G02784250.00000000000006002591555650462DDB_G0278425 on chromosome: 3
position 866714 to 870080
OxytrichaContig19254.0.g440.00000000002000577768187062Cid1 family poly A polymerase
WormBaseWBGene000015960.0000000020002373268528243locus:gld-2 Poly(A) RNA poly
merase gld-2 status:Confirme
d UniProt:O17087 protein_i
d:CCD72658.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01050360(coding)
AAAAAAAACTAACTAGAACTCAAATTTTACTAATTAAGAAAATAGATAGTAATGAGTTTG
TATAATAAATACAAGCAAATACTCACCGAATTAATCACAACTTCAAAATAAGAAGACCTA
AGCAATCCATCTATTAACTTTGATTAAAAATTGGCTTATACTATCAAAAAGTATATGGAT
ATCCCTTTTAAATATTCAAAAGGCTTTGAAGATTACATTAAATAATAGGTAGAAATTATA
TGTAAGAATGAGTAAAATATTGAATTTTTTATAAATTGGAGAAATCTAATTGAGTAATTA
AAGGAAAAAACAAAAATATTAACTAAACAAAGCATAACCCTACTTGATTCTTTAATTGAA
ACAGCAAATTCGAGATTTGAAGCTTTAAAAACTGAAAATTAATTGAAGTAAGAAGAGGAT
TTCACTAATCAAATAAAAATGAATCAATCGAATATTTAAATGTCAGATAAAAGTATGAAT
GGTTTACTGCACACTTAGTCCAGCAACTAAATAAAATCAAGTACAATTAATTAGTAAGAT
TTGGAATAGAAGTTATAAGCTTAGAGCGATAACAATTAGAATCTCAACTGTTTGCATCCT
TAGTAATAGTCTTAATAACATTAAATACTTAATAATAATAATATATAAGATTTTAATAAT
AAATATGAATAATTAATGACTTAGCAAGGGGATTATTTAACTAATAATAATATTAACTAA
AAATAAAATAGCAACTTAAATAATCAGCAATAACATAACTAGGTGAAATGTGTCAATAAT
AATTGGAGCTCAAATGATATGGAGAAATATCTTATCTAGCAAGAAGGTAAATAGGCTCTT
TTAAAATCTGAATATAAAAGCAATTAAGTAGAAAACTAAAATTTATTTGATTCGTCCATA
GGTTGGTAAACTTTTGATTAGCAAAGCAAAAAATTCATAATAGAAAATGAAATTCTAATT
TATTAAGATGAATCAATTTACTTAAATAGCATAAAGAATGTCGATAAAATTGATTAAAAA
TTATATGAAATATATTCAAATTAAATATTAGAACAAGACAAGAAAAAGAAAATGATGGAA
TAATTAAAATATGTCCTTAATAATATATAGCAAAATGCAGAAATTCAAATTTCTAAAGAT
ATAATCTTAAAAGCTTATTTATTTGGTTCTTTCTTGCAAGGGACTTGTTTAAAAAAAGAA
TCAGATATTGATTTAATAATAATTTTTGAAAATAATTAATTAAGCTACAGAGATACCTTA
TTATTTATTTAAGAAACTATTAAAAATAAATTGAATGATTAATATATTATCACTCAGGAA
GTCTCATTTGCTTTTAATGTGCCTATTATTAGCATTTAGCATGTAAAAACTGGGTATAAA
ATAGATATTACCTATGAGAATAGATTAGCTATTTTAAACTCTTAGCTCTTTAATGTTTAC
CTAAACATTGATTTTAAAATTAAAGTTCTCTCTGTCTTGTTTAAAATTTGGGCTGTTAAG
TAAAATATCAAAAAAACAGACTTTTTAACTTCTTACGCTTTACTAAATATGGTGATATAT
TTTTTAATATCTTAAGGTTATCTAGTCAGCTTATAGCATAGCCAATATTTTGGTTTTGCA
CATTAAAAAGAAAATATTATCAATTATTCTAAGGGGCAAAAGGAAACTTAATAAATATAC
ACTAGCTTTGAAAAAAATATTGGCTAAATTAAGTCAAAACTTGTTAATTAACTTTAAAAG
CTAAATGAAAAACCTCTACATAAACTAATTACTGAACTATTTTCATTTTATAGAGTAATA
TTAAATCATAATGATTAATGTAAATAACATGAAAAAATTATCATTACAACTAGGCTATCA
ACAAATATTATGGGTGTTTTAAAATATGATTAAAATAAATAATACATTTCCATCTAAGAT
CCTTTTAATGATTAGTACAACCCTGGATAAAGATGGAATTTTGATGTAAACTACTTTTAT
TAAAAATTAAGTTAAGTTCCTCTTCAGTTTTAAGATATTGATTAATTAAGCGAATTATTT
GATTGA


>TTHERM_01050360(protein)
KKNQLELKFYQLRKQIVMSLYNKYKQILTELITTSKQEDLSNPSINFDQKLAYTIKKYMD
IPFKYSKGFEDYIKQQVEIICKNEQNIEFFINWRNLIEQLKEKTKILTKQSITLLDSLIE
TANSRFEALKTENQLKQEEDFTNQIKMNQSNIQMSDKSMNGLLHTQSSNQIKSSTINQQD
LEQKLQAQSDNNQNLNCLHPQQQSQQHQILNNNNIQDFNNKYEQLMTQQGDYLTNNNINQ
KQNSNLNNQQQHNQVKCVNNNWSSNDMEKYLIQQEGKQALLKSEYKSNQVENQNLFDSSI
GWQTFDQQSKKFIIENEILIYQDESIYLNSIKNVDKIDQKLYEIYSNQILEQDKKKKMME
QLKYVLNNIQQNAEIQISKDIILKAYLFGSFLQGTCLKKESDIDLIIIFENNQLSYRDTL
LFIQETIKNKLNDQYIITQEVSFAFNVPIISIQHVKTGYKIDITYENRLAILNSQLFNVY
LNIDFKIKVLSVLFKIWAVKQNIKKTDFLTSYALLNMVIYFLISQGYLVSLQHSQYFGFA
HQKENIINYSKGQKETQQIYTSFEKNIGQIKSKLVNQLQKLNEKPLHKLITELFSFYRVI
LNHNDQCKQHEKIIITTRLSTNIMGVLKYDQNKQYISIQDPFNDQYNPGQRWNFDVNYFY
QKLSQVPLQFQDIDQLSELFD


>TTHERM_01050360(gene)
AAAAAAAAACTAACTAGAACTCAAATTTTACTAATTAAGAAAATAGATAGTAATGAGTTT
GTATAATAAATACAAGCAAATACTCACCGAATTAATCACAACTTCAAAATAAGAAGACCT
AAGCAATCCATCTATTAACTTTGATTAAAAATTGGCTTATACTATCAAAAAGTATATGGA
TATCCCTTTTAAATATTCAAAAGGCTTTGAAGATTACATTAAATAATAGGTAGAAATTAT
ATGTAAGAATGAGTAAAATATTGAATTTTTTATAAATTGGAGAAATCTAATTGAGTAATT
AAAGGAAAAAACAAAAATATTAACTAAACAAAGCATAACCCTACTTGATTCTTTAATTGA
AACAGCAAATTCGAGATTTGAAGCTTTAAAAACTGAAAATTAATTGAAGTAAGAAGAGGA
TTTCACTAATCAAATAAAAATGAATCAATCGAATATTTAGTAAATATTTGTAAAATTTAA
CTTAAATATGTAAAAAATATTATAAATATATTAGCAGAATGTCAGATAAAAGTATGAATG
GTTTACTGCACACTTAGTCCAGCAACTAAATAAAATCAAGTACAATTAATTAGTAAGATT
TGGAATAGAAGTTATAAGCTTAGAGCGATAACAATTAGAATCTCAACTGTTTGCATCCTT
AGTAATAGTCTTAATAACATTAAATACTTAATAATAATAATATATAAGATTTTAATAATA
AATATGAATAATTAATGACTTAGCAAGGGGATTATTTAACTAATAATAATATTAACTAAA
AATAAAATAGCAACTTAAATAATCAGCAATAACATAACTAGGTGAAATGTGTCAATAATA
ATTGGAGCTCAAATGATATGGAGAAATATCTTATCTAGCAAGAAGGTAAATAGGTAAAAT
TTTAATTACTTAACAATTTAAAATTTATAATTAATTATATAATGTTCTAAAAAATAGGCT
CTTTTAAAATCTGAATATAAAAGCAATTAAGTAGAAAACTAAAATTTATTTGATTCGTCC
ATAGGTTGGTAAACTTTTGATTAGCAAAGCAAAAAATTCATAATAGAAAATGAAATTCTA
ATTTATTAAGATGAATCAATTTACTTAAATAGCATAAAGAATGTCGATAAAATTGATTAA
AAATTATATGAAATATATTCAAATTAAATATTAGAACAAGACAAGAAAAAGAAAATGATG
GAATAATTAAAATATGTCCTTAATAATATATAGCAAAATGCAGAAATTCAAATTTCTAAA
GATATAATCTTAAAAGCTTATTTATTTGGTTCTTTCTTGCAAGGGACTTGTTTAAAAAAA
GAATCAGATATTGATTTAATAATAATTTTTGAAAATAATTAATTAAGCTACAGAGATACC
TTATTATTTATTTAAGAAACTATTAAAAATAAATTGAATGATTAATATATTATCACTCAG
GAAGTCTCATTTGCTTTTAATGTGCCTATTATTAGCATTTAGCATGTAAAAACTGGGTAT
AAAATAGATATTACCTATGAGAATAGATTAGCTATTTTAAACTCTTAGCTCTTTAATGTT
TACCTAAACATTGATTTTAAAATTAAAGTTCTCTCTGTCTTGTTTAAAATTTGGGCTGTT
AAGTAAAATATCAAAAAAACAGACTTTTTAACTTCTTACGCTTTACTAAATATGGTGATA
TATTTTTTAATATCTTAAGGTTATCTAGTCAGCTTATAGCATAGCCAATATTTTGGTTTT
GCACATTAAAAAGAAAATATTATCAATTATTCTAAGGGGCAAAAGGAAACTTAATAAATA
TACACTAGCTTTGAAAAAAATATTGGCTAAATTAAGTCAAAACTTGTTAATTAACTTTAA
AAGCTAAATGAAAAACCTCTACATAAACTAATTACTGAACTATTTTCATTTTATAGAGTA
ATATTAAATCATAATGATTAATGTAAATAACATGAAAAAATTATCATTACAACTAGGCTA
TCAACAAATATTATGGGTGTTTTAAAATATGATTAAAATAAATAATACATTTCCATCTAA
GATCCTTTTAATGATTAGTACAACCCTGGATAAAGATGGAATTTTGATGTAAACTACTTT
TATTAAAAATTAAGTTAAGTTCCTCTTCAGTTTTAAGATATTGATTAATTAAGCGAATTA
TTTGATTGA