Identifiers and Description

Gene Model Identifier

TTHERM_01046850

Standard Name

FIMP1 (FACT-interacting mysterious protein 1)

Aliases

PreTt05032 | 210.m00039

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.8%

TetraMine Data

TTHERM_01046850

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14078.17.001220308967917e-48hypothetical protein (540 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_01046850(coding)
ATGGCCTCCTATGAATAATAATAGCTTGCTTCGTTAATTGGATTAATTTTTGAAAGAAAA
TAACAACACTATGAAGTTCAAAAAGATATGGTTATCAAGTGCAATCAGCTACAGGAGAAG
GCTTGTTAAATAAAGCAACTTTACAATGATATTGCGGAGAAAGATAGAATAAAAAATATA
CTCACGAATCCTCAAGCTTAATTTGATGATGCATAGATAGAACTTCAAAAAATAATAGAG
GAAAAAGTGCAAAAGTAGCAAGAAACAGAAAATTTGCTTAAAAATTTTTTGAAAGCACAC
GAAAAAAAGTTTGATCAAAATTAACCAAATCAAATAAAGGTCAACATAATTAATTTAATC
AGAAATATAAATTTTTTCAAAGAAAACGAATAAGTTTAAGTGTATAAATAGAATGAAAGC
AACCATGTCAATTAAATAATCAGCATGATCTCAAATAAATCTAATTTATGTTCATCTGAA
TTTATCAACAAATTCAAATAGATTGTCAATAAATATTAGTTTATTTTTGATGATCTAAAA
GGAGTTTAAATATACAAAGATGGATTTTAGAAGCCAATCAATTTTGAAGATTTTTCTGAG
TTTTAAATGTCATAAATAAGTAAGTATTCTGATATTATTCATAACGGATAACAGTAAAAT
GTTGAGTAATCTCCTTAAATTAAGTAATTTATGAAGCTAGTTAATTAAAAGTAAGAGTGT
TTGCCAAACTAAATCAAGGAAAAAATCTAAAAAGTGTATTTAAGTATATCCCCTTTTTTA
GAAGGAGTGGATTTAACAATGCCTTAGAATATAAACTACCTATTGGAATATCCCTTTATC
AAAAGCAATTTTTATAACTCATAATAGGATCTACAAATTATAGCTCTTGGAGACTAAAGT
ATTCAATTCACGAAAACCAGTTAGGAGGATGATTACTACAACAACATTATTTCAACATTA
TTTATTGATAAAAACATTACCTATTCAGTCATTTTTGAAGTTTCTTACTAAAATCAGGAC
CATTTTTCATTTTTCATAGGCTTGACAACCAAAGGAAATACAGATCATTTATATAACGAA
AAGTTATCATTTTGTATAGCTTCTAAGGATCTTAATAATGGCTATGGAATTGATTGTGTA
AAGCAAGGTGATAAAATGAGATTAAGGAAAAATTTCAAATAATTCTAATTTAAAATTAAC
CTTTCTGAAGGATTAGTTGAAGTGTCTGACTACCCAAATAGCTACAACATTATCAAACTA
GATGAAAATAAAAAAAGTACTATCCTTGAAAAGTCAGGCTTATATTAAATAGGTTTTTCA
ATAAGAAGCAAGTCAGATTCTATAATAATAAAATAGTTAAATGTCAGCATTGATTGA


>TTHERM_01046850(protein)
MASYEQQQLASLIGLIFERKQQHYEVQKDMVIKCNQLQEKACQIKQLYNDIAEKDRIKNI
LTNPQAQFDDAQIELQKIIEEKVQKQQETENLLKNFLKAHEKKFDQNQPNQIKVNIINLI
RNINFFKENEQVQVYKQNESNHVNQIISMISNKSNLCSSEFINKFKQIVNKYQFIFDDLK
GVQIYKDGFQKPINFEDFSEFQMSQISKYSDIIHNGQQQNVEQSPQIKQFMKLVNQKQEC
LPNQIKEKIQKVYLSISPFLEGVDLTMPQNINYLLEYPFIKSNFYNSQQDLQIIALGDQS
IQFTKTSQEDDYYNNIISTLFIDKNITYSVIFEVSYQNQDHFSFFIGLTTKGNTDHLYNE
KLSFCIASKDLNNGYGIDCVKQGDKMRLRKNFKQFQFKINLSEGLVEVSDYPNSYNIIKL
DENKKSTILEKSGLYQIGFSIRSKSDSIIIKQLNVSID


>TTHERM_01046850(gene)
ATGGCCTCCTATGAATAATAATAGCTTGCTTCGTTAATTGGATTAATTTTTGAAAGAAAA
TAACAACACTGTAAATTAAACACAAATTATTTAACAATATTTTGATAGCTTGAAGTAAGA
AGTAAATAAATTTATAGATGAAGTTCAAAAAGATATGGTTATCAAGTGCAATCAGCTACA
GGAGAAGGCTTGTTAAATAAAGCAACTTTACAATGATATTGCGGAGAAAGATAGAATAAA
AAATATACTCACGAATCCTCAAGCTTAATTTGATGATGCATAGATAGAACTTCAAAAAAT
AATAGAGGAAAAAGTGCAAAAGTAGCAAGAAACAGAAAATTTGCTTAAAAATTTTTTGAA
AGCACACGAAAAAAAGTTTGATCAAAATTAACCAAATCAAATAAAGGTCAACATAATTAA
TTTAATCAGAAATATAAATTTTTTCAAAGAAAACGAATAAGTTTAAGTGTATAAATAGAA
TGAAAGCAACCATGTCAATTAAATAATCAGCATGATCTCAAATAAATCTAATTTATGTTC
ATCTGAATTTATCAACAAATTCAAATAGATTGTCAATAAATATTAGTTTATTTTTGATGA
TCTAAAAGGAGTTTAAATATACAAAGATGGATTTTAGAAGCCAATCAATTTTGAAGATTT
TTCTGAGTTTTAAATGTCATAAATAAGTAAGTATTCTGATATTATTCATAACGGATAACA
GTAAAATGTTGAGTAATCTCCTTAAATTAAGTAATTTATGAAGCTAGTTAATTAAAAGTA
AGAGTGTTTGCCAAACTAAATCAAGGAAAAAATCTAAAAAGTGTATTTAAGTATATCCCC
TTTTTTAGAAGGAGTGGATTTAACAATGCCTTAGAATATAAACTACCTATTGGAATATCC
CTTTATCAAAAGCAATTTTTATAACTCATAATAGGATCTACAAATTATAGCTCTTGGAGA
CTAAAGTATTCAATTCACGAAAACCAGTTAGGAGGATGATTACTACAACAACATTATTTC
AACATTATTTATTGATAAAAACATTACCTATTCAGTCATTTTTGAAGTTTCTTACTAAAA
TCAGGACCATTTTTCATTTTTCATAGGCTTGACAACCAAAGGAAATACAGATCATTTATA
TAACGAAAAGTTATCATTTTGTATAGCTTCTAAGGATCTTAATAATGGCTATGGAATTGA
TTGTGTAAAGCAAGGTGATAAAATGAGATTAAGGAAAAATTTCAAATAATTCTAATTTAA
AATTAACCTTTCTGAAGGATTAGTTGAAGTGTCTGACTACCCAAATAGCTACAACATTAT
CAAACTAGATGAAAATAAAAAAAGTACTATCCTTGAAAAGTCAGGCTTATATTAAATAGG
TTTTTCAATAAGAAGCAAGTCAGATTCTATAATAATAAAATAGTTAAATGTCAGCATTGA
TTGA