Identifiers and Description

Gene Model Identifier

TTHERM_01034460

Standard Name

None

Aliases

PreTt22682 | 205.m00071

Description

ribosomal protein L20 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.1%

TetraMine Data

TTHERM_01034460

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20048.13.9981372112117256e-92ribosomal protein L20 containi
ng protein (170 aa)
OxytrichaContig15153.0.g1022.9993110246221282e-28Ribosomal protein L20
DictyBaseDDB_G02732953.99801309251602e-27DDB_G0273295 on chromosome: 2
position 2642763 to 2643257
Stentor CoeruleusSteCoe_166151.0530617357553812e-20
WormBaseWBGene000129920.0000008998839737394744locus:mrpl-20 status:Confirm
ed UniProt:Q9NAG2 protein_
id:CAB55109.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01034460(coding)
ATGACAGGATTTTCAAGAGAAAAGTATAGAAAGTTAGCAAGGGGATTCTTTGGTCGTAAT
AAGAATTGTTTGCGTACTATGGCCCCTCGTGTTGATAAGGCTTTGAGATATTCATTCAGA
GATAGAAGAGCTAGAAGAAGAATCTATCGTAAAGAATGGATTCAAACTATTAATGCAGCC
GTAAGAGAACACAATACTCCTTACAATAGATTTATTTGGGCTTTAAATTAATCCAATATT
ATCCTTGATAGAAAGATACTTTCTAATCTTGCAATTAATGAACCATTCTCCTTCAAGGCT
GTTTTGGATGAAGTCAGAATTCAAGCTTAATTATAATCCAAGCCTCATCCCCGTATTATT
AATCCTATTGAAGCTTATGCCAAAAAATTGATTATTGATGGAGCTCTCAAGCCAGTCCAA
ACTCAAGTTGAAGAACCTTTGCCCTATTTATTCGGAAAGAGATAAAATGTCGAAGAAATT
AAGAAAAAATATTAAGCTCAAGTACACAATTGA


>TTHERM_01034460(protein)
MTGFSREKYRKLARGFFGRNKNCLRTMAPRVDKALRYSFRDRRARRRIYRKEWIQTINAA
VREHNTPYNRFIWALNQSNIILDRKILSNLAINEPFSFKAVLDEVRIQAQLQSKPHPRII
NPIEAYAKKLIIDGALKPVQTQVEEPLPYLFGKRQNVEEIKKKYQAQVHN


>TTHERM_01034460(gene)
ATGACAGGATTTTCAAGAGAAAAGTATAGAAAGTTAGCAAGGGGATTCTTTGGTCGTAAT
AAGAATTGTTTGCGTACTATGGCCCCTCGTGTTGATAAGGCTTTGAGATATTCATTCAGA
GATAGAAGAGCTAGAAGAAGAATCTATCGTAAAGAATGGATTCAAACTATTAATGCAGCC
GTAAGAGAACACAATACTCCTTACAATAGATTTATTTGGGCTTTAAATTAATCCAATATT
ATCCTTGATAGAAAGATACTTTCTAATCTTGCAATTAATGAACCATTCTCCTTCAAGGCT
GTTTTGGATGAAGTCAGAATTCAAGCTTAATTATAATCCAAGCCTCATCCCCGTATTATT
AATCCTATTGAAGCTTATGCCAAAAAATTGATTATTGATGGAGCTCTCAAGCCAGTCCAA
ACTCAAGTTGAAGAACCTTTGCCCTATTTATTCGGAAAGAGATAAAATGTCGAAGAAATT
AAGAAAAAATATTAAGCTCAAGTACACAATTGA