Identifiers and Description

Gene Model Identifier

TTHERM_01028770

Standard Name

None

Aliases

PreTt10806 | 204.m00035

Description

conserved hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

  • ( PF08153 ) NGP1NT (NUC091) domain
  • ( TIGR00436 ) GTP-binding protein Era
  • ( PF01926 ) GTPase of unknown function
  • ( TIGR00231 ) small GTP-binding protein domain
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_01028770

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10484.19.997093137033517e-262hypothetical protein (575 aa)
OxytrichaContig11968.0.g331.9991691033935208e-179NGP1NT (NUC091) domain
DictyBaseDDB_G02802892.0005951135209932e-158DDB_G0280289 on chromosome: 3
position 3208817 to 3211777
WormBaseWBGene000035963.0001680331469735e-143locus:ngp-1 status:Confirmed
UniProt:Q56VZ2 protein_id
:CAI79270.1
SGDYNR053C2.0007019863683806e-141NOG2 Putative GTPase that asso
ciates with pre-60S ribosomal
subunits in the nucleolus and
is required for their nuclear
export and maturation
Stentor CoeruleusSteCoe_218885.440559879258653e-75

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01028770(coding)
ATGGTTAAAAAAGTTTCAAAGAGTGTCAAGCACGCTGAAAAAATGTAAAAGAAGTGGCAA
TCTAACTAAAAGAAGCCATCTAAGTCTAATAACTCAGATAATCCTAATAGAAAGTTACCA
GGAATGGGTGAAGGTAAATGGACTCACGTCCGTACTAAAAATGCTATTAAGCGTTTGAAT
ATGTACAAGGACAAGCCTGATTATGAAGCTATGAGAAAATAGCCTTCAGGTCCCTCTAGA
ATTGAACCTGATAGAAAGTGGTTCGGTCCTGTTAGAACTATCGATTAAAAGAGTTTAGAA
AGATTTAGAGTTGAAATGTAATAAAAATCTAATGATCCCCGTCATGTTTTAGTCAAATCT
AAAAAACTCCCCATTTCTCTTCTTACAGATGCCAATAACGAAACTAAAATGAACATCTTA
GATATTGAAAAATATGAAGAAACTTTTGGACCTAAGGCCAGTAGAAAGAGAGTTAAATCA
ACATCTTACTCATATGAAGATTTAATATAATAAGTAGAGGAAAATGATCAAAAATATGAT
CCTAAGAAGGATTAAGATTTAACTAAGCACTAAATGCTAGACTTTAAGAACGAATGCAGA
GATAGACGTATGGAAGCTGGTCAATCTAGAAGAATTTGGGAAGAATTATATAAAGTACTT
GATGCCTCTGATGTTATAGTTTAAATTTTGGATGCCAGAAATCCTATGGGTACTCGTTCA
AAGCACGTAGAAGAACACATTAAGAAGAACTGCCCATATAAGCATTTAGTTTTTGTTATG
AATAAGTGTGATTTGATTCCTACTTGGTTGACAACAAAATGGTTAAGATATTTGAATAAG
GAATTCCCCACTATTGCATATCATGCTTCTTTGAATAATCCTTTTGGTAAAGGTTCTCTT
ATTAACTTGTTGAGATAATATGATAACATCCACAAAGATAAGAAACACATTTCTGTTGGT
TTTATTGGTTATCCTAATGTTGGTAAGTCTTCAATTATTAACTCATTGAAGCAAAAGAAG
GTCTGTAAAAGTGCTCCCATTCCTGGTGAAACTCGTGTTTGGTAATATATCACTTTAACT
AAAAGAATTTATCTTATCGATTGTCCTGGTGTTGTTTACTATCACGATGGTCGTGATGAT
ACAGAAGTCGTACTTAAGGGTTGTATTCGTGCTGAAAAAATTGATGATCCTACTTTCTAT
ATCCATGTTATTCTTTAAAAAACAAATCCTATCCACATTAAAAAAACTTATGGTGTAAAT
GAATGGGAAGATGACTAAGATTTCTTAGAAAAATTAGCAGTCAAAAAGGGTAAACTTAAA
AAGGGTGGTGAACCTGATATTATAACAGTTGCAAAAATTGTTATTATGGATTGGTAAAGA
GGTGTAATTCCTTACTTCAACTTCCCTCCTGATTATAAACCTGATGAGGAAATGAATAAA
AATAAAATTGAAGCATCTAAAATCGGAGAAGAAAATATAGACGCATAAGCCATAGAAGAA
GTTAATAAGGAAATAGAAGTTAAAGTTATTTAAGAAACTAATGAATAATATAAGGAAAGA
TTAGCTAATGATATAAATAAAGATATAAAAGAAGCTAATGATGATGATATAGAAGCCGAA
AATGGAGAAGAGGATGATGATGATGAAGAAGAAGAAATCGAAGGAGAAGAAGAAGATGGT
GATGATGATGATTAAAGCGAAGAAATGAAAGATGAATGA


>TTHERM_01028770(protein)
MVKKVSKSVKHAEKMQKKWQSNQKKPSKSNNSDNPNRKLPGMGEGKWTHVRTKNAIKRLN
MYKDKPDYEAMRKQPSGPSRIEPDRKWFGPVRTIDQKSLERFRVEMQQKSNDPRHVLVKS
KKLPISLLTDANNETKMNILDIEKYEETFGPKASRKRVKSTSYSYEDLIQQVEENDQKYD
PKKDQDLTKHQMLDFKNECRDRRMEAGQSRRIWEELYKVLDASDVIVQILDARNPMGTRS
KHVEEHIKKNCPYKHLVFVMNKCDLIPTWLTTKWLRYLNKEFPTIAYHASLNNPFGKGSL
INLLRQYDNIHKDKKHISVGFIGYPNVGKSSIINSLKQKKVCKSAPIPGETRVWQYITLT
KRIYLIDCPGVVYYHDGRDDTEVVLKGCIRAEKIDDPTFYIHVILQKTNPIHIKKTYGVN
EWEDDQDFLEKLAVKKGKLKKGGEPDIITVAKIVIMDWQRGVIPYFNFPPDYKPDEEMNK
NKIEASKIGEENIDAQAIEEVNKEIEVKVIQETNEQYKERLANDINKDIKEANDDDIEAE
NGEEDDDDEEEEIEGEEEDGDDDDQSEEMKDE


>TTHERM_01028770(gene)
ATGGTTAAAAAAGTTTCAAAGAGTGTCAAGCACGCTGAAAAAATGTAAAAGAAGTGGCAA
TCTAACTAAAAGAAGCCATCTAAGTCTAATAACTCAGATAATCCTAATAGAAAGTTACCA
GGAATGGGTGAAGGTAAATGGACTCACGTCCGTACTAAAAATGCTATTAAGCGTTTGAAT
ATGTACAAGGACAAGCCTGATTAGTAATTAATTTATATTTTAATTTAGTTAAAATATTTT
TAATAGATATTCTAAATATGATCTCTATTCTTTTTATGATTTCTTTGCTTTAGCTATCGT
TTTTAAATCCATTTTCTTATTATTTTTAAATAGTGAAGCTATGAGAAAATAGCCTTCAGG
TCCCTCTAGAATTGAACCTGATAGAAAGTGGTTCGGTCCTGTTAGAACTATCGATTAAAA
GAGTTTAGAAAGATTTAGAGTTGAAATGTAATAAAAATCTAATGATCCCCGTCATGTTTT
AGTCAAATCTAAAAAACTCCCCATTTCTCTTCTTACAGATGCCAATAACGAAACTAAAAT
GAACATCTTAGATATTGAAAAATATGAAGTAAAGTTTTAAAGATTTTTTATTAAGCTTTT
ATTCTTATAAGGGAGATGAAATTGTTCTATCAACTAACTTCCCTTTTTAAAGATTACTAG
AATATAATTTTATCAAGTAAAAGTGTTAAATGAATGATATTTTGTTATAAATAGGAAACT
TTTGGACCTAAGGCCAGTAGAAAGAGAGTTAAATCAACATCTTACTCATATGAAGATTTA
ATATAATAAGTAGAGGAAAATGATCAAAAATATGATCCTAAGAAGGATTAAGATTTAACT
AAGCACTAAGTAAAATAAAATAAATTTAATTAAGCAAAATAAGTTAATGTCCTCCTTTTA
AATAGATGCTAGACTTTAAGAACGAATGCAGAGATAGACGTATGGAAGCTGGTCAATCTA
GAAGAATTTGGGAAGAATTATATAAAGTACTTGATGCCTCTGATGTTATAGTTTAAATTT
TGGATGCCAGAAATCCTATGGGTACTCGTTCAAAGCACGTAGAAGAACACATTAAGAAGA
ACTGCCCATATAAGCATTTAGTTTTTGTTATGAATAAGTGTGATTTGATTCCTACTTGGT
TGACAGTAAATAATTAAATTTTAAGCAAATTGAGCTATTGAAAAAAATAAAAAAACATAC
AAAATATTATTTTTAAATAGCAACTTAAATAATTAATTTTTAAAATTTTACTAATTTTTG
TTATTTTTATAATAGACAAAATGGTTAAGATATTTGAATAAGGAATTCCCCACTATTGCA
TATCATGCTTCTTTGAATAATCCTTTTGGTAAAGGTTCTCTTATTAACTTGTTGAGATAA
TATGATAACATCCACAAAGATAAGAAACACATTTCTGTTGGTTTTATTGGTTATCCTAAT
GTTGGTAAGTCTTCAATTATTAACTCATTGAAGCAAAAGAAGGTCTGTAAAAGTGCTCCC
ATTCCTGGTGAAACTCGTGTTTGGTAATATATCACTTTAACTAAAAGAATTTATCTTATC
GATTGTCCTGGTGTTGTTTACTATCACGATGGTCGTGATGATACAGAAGTCGTACTTAAG
GGTTGTATTCGTGCTGAAAAAATTGATGATCCTACTTTCTATATCCATGTTATTCTTTAA
AAAACAAATCCTATCCACATTAAAAAAACTTATGGTGTAAATGAATGGGAAGATGACTAA
GATTTCTTAGAAAAATTAGCAGTCAAAAAGGGTAAACTTAAAAAGGTAAATTTTTATAGT
TTATTAATTAATTAATTAAAATATATACTTCAATTACTTTACATATATTACTTTATCCTA
TTTTATTTATTTTAAATTAATATCCAAATTAAAATTTTAGTAAAATTTTTTTTTCAAAAT
GCAATCAAATTTAGATTTTAAATATTTTAAGGTTTATTTATTAAGATATTTAAATTTTAC
TTATTAAAATAGGGTGGTGAACCTGATATTATAACAGTTGCAAAAATTGTTATTATGGAT
TGGTAAAGAGGTGTAATTCCTTACTTCAACTTCCCTCCTGATTATAAACCTGATGAGGAA
ATGAATAAAAATAAAATTGAAGCATCTAAAATCGGAGAAGAAAATATAGACGCATAAGCC
ATAGAAGAAGTTAATAAGGAAATAGAAGTTAAAGTTATTTAAGAAACTAATGAATAATAT
AAGGAAAGATTAGCTAATGATATAAATAAAGATATAAAAGAAGCTAATGATGATGATATA
GAAGCCGAAAATGGAGAAGAGGATGATGATGATGAAGAAGAAGAAATCGAAGGAGAAGAA
GAAGATGGTGATGATGATGATTAAAGCGAAGAAATGAAAGATGAATGA