Identifiers and Description

Gene Model Identifier

TTHERM_01027470

Standard Name

None

Aliases

PreTt17976 | 203.m00031 | 3803.m00191

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 80.5%

TetraMine Data

TTHERM_01027470

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20086.19.997093137033517e-262glutamine aminotransferase cla
ss-I family protein (343 aa)
DictyBaseDDB_G02865351.9998745702418095e-48gghA on chromosome: 4 position
4609676 to 4610629
OxytrichaContig13071.0.g301.9991939848149086e-44Peptidase C26
Stentor CoeruleusSteCoe_83031.0530617357553812e-20

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01027470(coding)
ATGAAAAGGCTACTATTGATAAGTTTAATTGCATTGACTGTTCTAGCAGGTTAATATGAA
AACTAATACCAACCTGTGATTGGAGTTTTGACTCAACCTTCTAATGATTTGAATTAAACT
TTATATCCAGCTGACAAGTATTCATACATTTCTAGTTCTTATGTCAAATGGTTGATGGCT
AGTGGTGCTAGAGTTGTTCCTATTCCTTATGATAGTACTGAAGAAGAATAAGATTATTAT
TTAGCTAAAGTTAATGGTTTACTTTTCCCAGGTGGAGATGCATCCTTATGGGTTGATGAA
GAAACTCATACTGGATTATCTTAAATGACTTTGACAGGATAAAGATTAATGAACAAAGTT
ATAGAATTAAATAGAAATGGAACTTACTTCCCATTACTAGGTACTTGCTTGGGTTACGAA
CTTATTTCAATTGCTCTTACTAATGATGACAAAGTCTTAGACCTACTTAATTCTACTAAC
CATGTCCTTAACACTCAAACTTATCATAAATAATAAAGTTTGATGTATTCTTCTTTAAAC
AGCAAGTAATTAGAAGCTATTAGTAATTAAAAGGCACTTTACTATAACCACAGATATGGA
ATAACATTAGATCACTTTAGAAATTAAACTGTATTAAACTCATTCTTCAGATTAACAGCT
TTTGCTTTTGATAACAATGATACAGCCTTCGTATCTTCATTAGAGGGTAAGGATATTCCC
ATTTTTGGTAATTAATTCCATCCAGAAAAGAACTCTTATGAATGGCTTAGCTCAGTCCAT
GCTAATCACTCTCCAGAAGCTATTAATGTAGCTTAAGCAATGGGAAATTTTATTGTTAAT
TAAGCTAGAAAAAATTAAAATTACTTTTCATAAGATGAGCTTGAGCAATACAACATCGAA
GCTTTCCCATTAAAAACAGTTTATGAATCATTTGTTTCTGTTTATGTTTTTAAAAACAAA
AATTTCACAGAGACAATCTCAGCTCCTAGTAATTTAAAGAATAACTTATGA


>TTHERM_01027470(protein)
MKRLLLISLIALTVLAGQYENQYQPVIGVLTQPSNDLNQTLYPADKYSYISSSYVKWLMA
SGARVVPIPYDSTEEEQDYYLAKVNGLLFPGGDASLWVDEETHTGLSQMTLTGQRLMNKV
IELNRNGTYFPLLGTCLGYELISIALTNDDKVLDLLNSTNHVLNTQTYHKQQSLMYSSLN
SKQLEAISNQKALYYNHRYGITLDHFRNQTVLNSFFRLTAFAFDNNDTAFVSSLEGKDIP
IFGNQFHPEKNSYEWLSSVHANHSPEAINVAQAMGNFIVNQARKNQNYFSQDELEQYNIE
AFPLKTVYESFVSVYVFKNKNFTETISAPSNLKNNL


>TTHERM_01027470(gene)
ATGAAAAGGCTACTATTGATAAGTTTAATTGCATTGACTGTTCTAGCAGGTTAATATGAA
AACTAATACCAACCTGTGATTGGAGTTTTGACTCAACCTTCTAATGATTTGAATTAAACT
TTATATCCAGCTGACAAGTATTCATACATTTCTAGTTCTTATGTCAAATGGTTGATGGCT
AGTGGTGCTAGAGTTGTTCCTATTCCTTATGATAGTACTGAAGAAGAATAAGATTATTAT
TTAGCTAAAGTTAATGGTTTACTTTTCCCAGGTGGAGATGCATCCTTATGGGTTGATGAA
GAAACTCATACTGGATTATCTTAAATGACTTTGACAGGATAAAGATTAATGAACAAAGTT
ATAGAATTAAATAGAAATGGAACTTACTTCCCATTACTAGGTACTTGCTTGGGTTACGAA
CTTATTTCAATTGCTCTTACTAATGATGACAAAGTCTTAGACCTACTTAATTCTACTAAC
CATGTCCTTAACACTCAAACTTATCATAAATAATAAAGTTTGATGTATTCTTCTTTAAAC
AGCAAGTAATTAGAAGCTATTAGTAATTAAAAGGCACTTTACTATAACCACAGATATGGA
ATAACATTAGATCACTTTAGAAATTAAACTGTATTAAACTCATTCTTCAGATTAACAGCT
TTTGCTTTTGATAACAATGATACAGCCTTCGTATCTTCATTAGAGGGTAAGGATATTCCC
ATTTTTGGTAATTAATTCCATCCAGAAAAGAACTCTTATGAATGGCTTAGCTCAGTCCAT
GCTAATCACTCTCCAGAAGCTATTAATGTAGCTTAAGCAATGGGAAATTTTATTGTTAAT
TAAGCTAGAAAAAATTAAAATTACTTTTCATAAGATGAGCTTGAGCAATACAACATCGAA
GCTTTCCCATTAAAAACAGTTTATGAATCATTTGTTTCTGTTTATGTTTTTAAAAACAAA
AATTTCACAGAGACAATCTCAGCTCCTAGTAATTTAAAGAATAACTTATGA