Identifiers and Description

Gene Model Identifier

TTHERM_01020880

Standard Name

None

Aliases

PreTt17655 | 200.m00068 | 3756.m00264

Description

arsenite-resistance protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.7%

TetraMine Data

TTHERM_01020880

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19306.19.997093137033517e-262hypothetical protein (597 aa)
OxytrichaContig15516.0.0.g971.9997255150861791e-53Domain of unknown function (DU
F3546)
Stentor CoeruleusSteCoe_2371.185064864233981e-27
WormBaseWBGene000170858.002082816694397e-20Serrate RNA effector molecule
homolog status:Confirmed U
niProt:Q966L5 protein_id:CCD
68572.1
DictyBaseDDB_G02773751.000116773704384e-19DDB_G0277375 on chromosome: 2
position 7905630 to 7909062

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01020880(coding)
ATGTTTGATAATTAAATAAAAAACAAAAGAAAGAAAAGAAAGAAAAAGCATATAGCTAAA
TTTAGGAAATTTTTATAATTAATGGAACAAAGTCGTACCCCCAGTTCTGAAAAATAGCGC
AAGCGTAGTTCATCACGCAGTTCGAAGTCAGAAAGCAGAACAAAGCTCAAAGATAGAAAG
AGTAGAAGCAGATCTAGAAGTATTTCTAATGACAGAAAAAAATCTAGGTACATGAGTGAT
GACAAATTTGGAGGAAGAAAGTAATCAAGCAAACCTTTCAGAAAAATTAGATACAACATT
CCAATGTTGGATGGCCCCCTAGTCAATTTTAGATAGTTTATGGAGCTTCAGACTGATAGA
GTGGATACACATAAGGCTGAGACTCACTATCAATATTACAAAAAGCATTGGGAAAAAAGA
CAAAATGAAATATTTGTTAAAGAACACATGGAAGAAGCATGGTTCAAAGAGAAGTATGAT
CCTATCATTAGTGAGGAAATACAAAAAGATAGACTTTCAGAATGCAAAAAAACTGCTGAA
AAGTTCATTGAAGATTATAAAAATAATGTATTTAACTCCATCTGCTTAGAAATTACTGAA
AATAAAATATAAGAAATAAAATCTGTTGAAAATAATGAAGAAGACTAAGAAGAAAATGAT
AAATAAACTGGTGTTGCTCATCAAAAAATTTATTTGAGCGAAAATTTCGACGTTACTCAA
TCTCCATATTTTGGATTTGACCCTGTTGTTCGTACTCTTTTCATTAAGACTATTCCTAAA
GAACTTGGACGTTAAGATATTTATGAAATTATTTAAAAAATTCCTGGCTTCTAAAGTTTA
TCTCTTTCTGAACCAGTTCCTAATCAATAATTCTAAAGATATGGTTGGATTACATTTGAA
ACAGAAGAGTAATGCAATTATGCAGCAGAAAGATTTAAAAGCGACTGTCTTGTTATTAAC
AAATATGAATTTAATATTGTAAAAAATAATCAAAAAAGAATGATAAAAGTAGCTTAAAAA
GTCGATCTTAAGAAATCTCAAACTGATTTTGAATAAATCATCAAACTTATTGCCAAGTTT
GACTAGTCAAAAACCATTACTGGTAATCCTTTAGTAGAGTTTAGCCCAGAAAATTTCTCT
TTCAAAAATCTCGATATTTGTCTTCTTTACTTACGTCGCATTCATTCTTATTGCTACTAT
AGTGGAGTTCACTGCAACGATGAGAGAATGCTTACAAGCAAGTGCGGATCTGTTCACTTA
AGACTTAAGTCTGATAACCCCAATGAAGAATGGGAATTACCTAATTGGTAAAATAAAGTA
CAAGATCTTGCTAATTAAAAAATTATAGAATTAGAACAAATAAAGGATTAACTTAAGGGT
GTTGCTTTATTCAAGGAGAGATTAGCTTCCAAAATAACTTACAAGGTACAAAAATAAATG
AAGAGCGAGAATGGAGCTTGGCCATGTTTCTATTGCTCCAAAAAATTCAAAGGCTCAGAA
TTCGTTGTTAAACACATTGATAATAAACACTCAAATGAAGAAAAGTATTAATAAGAACTC
AATAAGATAAGATCTGCAACAACTTTGGAATTGTATTCTAATGATAAAAATAAAATTACT
CATTAAGCACCTTAAAGCAAGGATGGTTAACATTTCCAAAACTTCATGAACAGAAACAAA
AAATTTAATGGAGGTTTTAATAAAGATAAAAAATACAATCAAAAAAGAAATTTTAACAAC
AACCATTAATTTAAAGATCTTGATGAACCTGAAATTGGAAACGAAACTCAAATTTCAAAT
AACACTGCAGGAGCTATTAATTATTTAGAAATTTGA


>TTHERM_01020880(protein)
MFDNQIKNKRKKRKKKHIAKFRKFLQLMEQSRTPSSEKQRKRSSSRSSKSESRTKLKDRK
SRSRSRSISNDRKKSRYMSDDKFGGRKQSSKPFRKIRYNIPMLDGPLVNFRQFMELQTDR
VDTHKAETHYQYYKKHWEKRQNEIFVKEHMEEAWFKEKYDPIISEEIQKDRLSECKKTAE
KFIEDYKNNVFNSICLEITENKIQEIKSVENNEEDQEENDKQTGVAHQKIYLSENFDVTQ
SPYFGFDPVVRTLFIKTIPKELGRQDIYEIIQKIPGFQSLSLSEPVPNQQFQRYGWITFE
TEEQCNYAAERFKSDCLVINKYEFNIVKNNQKRMIKVAQKVDLKKSQTDFEQIIKLIAKF
DQSKTITGNPLVEFSPENFSFKNLDICLLYLRRIHSYCYYSGVHCNDERMLTSKCGSVHL
RLKSDNPNEEWELPNWQNKVQDLANQKIIELEQIKDQLKGVALFKERLASKITYKVQKQM
KSENGAWPCFYCSKKFKGSEFVVKHIDNKHSNEEKYQQELNKIRSATTLELYSNDKNKIT
HQAPQSKDGQHFQNFMNRNKKFNGGFNKDKKYNQKRNFNNNHQFKDLDEPEIGNETQISN
NTAGAINYLEI


>TTHERM_01020880(gene)
ATGTTTGATAATTAAATAAAAAACAAAAGAAAGAAAAGAAAGAAAAAGCATATAGCTAAA
TTTAGGAAATTTTTATAATTAATGGAACAAAGTACTTATGAATTATTTTATAGATTTATA
GAATAAAATGATTTCAGTGTTACATGATAAAATAAACAAAATCAAAAATTAAATAGAGGA
GTGGCAATAAGACAATTAGTTAGTTAATTAGTAAATATGAAGCAACTTATCATAACATAA
CATACATCATTAATAAACATTATTGCAATAATAAATAAATAAATAAACATATTTTTATAT
CTACACATTAAGTGAAAACCAAAGAAATACTTACTCAAAAGTTGAACTTTTAAATTCCTC
TCAAAATCAATAAACATTTTACACTTTATATTCACATCTACTACATTTAAAATCATGCCA
ATAAGTTACTGCGCCCCTAAAGATATGCATTTTACTAATATCTAATAGACGCTCTTTATA
CATTTATCATGCACAACTGAAAATAATTTTTGTTGACTAACTTTTTCTTTTTCTTTATCT
TTCTTTTATATTCTGTTCAAATAGGTCGTACCCCCAGTTCTGAAAAATAGCGCAAGCGTA
GTTCATCACGCAGTTCGAAGTAATTATTTACAATTTTGCGCTTTTTATTCTTAAATTCAT
ATGATGAATCAATCACTCTGCATCTATCAATATTGCTTTGATTTAGAAAGCAAAATTTTG
TATTCCAATATGACAAATAATTTCTCATATAAAAAAATAAATGAATTTAACTTCAAATTC
TTCTACATTTTTTGATTTCTAATTTTTTCTTTTTACAATTATCTTAAAGGTCAGAAAGCA
GAACAAAGCTCAAAGGTTGACTTTCATTTTTATAACTAATTACAGATTAAATATACTTGA
TTATTATATCTAATCTTTCACTCTCCAACTTCTAAACAATTGACATATTAAAACAGATAG
AAAGAGTAGAAGCAGATCTAGAAGTATTTCTAATGACAGAAAAAAATCTAGGTACATGAG
TGATGGTAATATACAAATGTTATAATCATTATTTTAAACTTTAGAATGATTTTTTGGTGT
TTTTCAATCTCCAATAATTTCAAAAGGAACGTATGGTAAGATCCTCTTTAAAAATTTGAT
ATTTTTGATTATGTCTATGCAATAGTGCAGTGTAAAATTGTTTTATAACACCCTCACACG
CACTACACTACAAAAATCATTCTAAAGTTTCAAAAGAAAATTATTTAACAACAAAATATA
TCAACTCTTATCTGACTAAGCAATCTATTTTTTAAAAGACAAATTTGGAGGAAGAAAGTA
ATCAAGCAAACCTTTCAGAAAAATTAGATACAACATTCCAATGTTGGATGGCCCCCTAGT
CAATTTTAGATAGTTTATGGAGCTTCAGGTAAATACATCCCTTTATTATACACTTATTTT
AATACTTTTAACGCTAATTTTCATTTTTTTTCTTTGTTATTTTACACGCATCATTTCGAA
AGTGGGCCAAACCCAAAAATAAATAAACACAAACAAAAATTCTCAAAATTTATTTTATAT
TTAAGATTATAATTAAATTTCTTTTTTCCTTTCCAATACTTAATTTTCTTTTTTCCCTTC
TTTGTTTTTTCTAATTCATACTTCAAAAACTACAATTTGATCAATTAATTAATATTTTTT
TCACTTTCAGTAAATTTAAATTAAATTTAAAAGATCTTTATCTAAATCATCTCCATTTCA
TTTGTTTGTTTACTTTTACTTTAACTTAATCATTTTTTAATTATAATTATTCATTTTTTG
TTTTTTAAACTAGACTGATAGAGTGGATACACATAAGGCTGAGACTCACTATCAATATTA
CAAAAAGCATTGGGAAAAAAGACAAAATGAAATATTTGTTAAAGAACACATGGTAAGAAT
ATATTTAATAATTTTTATAAATAATAATTAAAAACTACATTAGGAAGAAGCATGGTTCAA
AGAGAAGTATGATCCTATCATTAGTGAGGAAATACAAAAAGATAGACTTTCAGAATGCAA
AAAAACTGCTGAAAAGTTCATTGAAGATTATAAAAATAATGTATTTAACTCCATCTGCTT
AGAAATTACTGAAAATGTATTTTATCAATCTATATTTATTTTATTAACATCATTAAAATT
CTAAAATTTTTTTAGAAAATATAAGAAATAAAATCTGTTGAAAATAATGAAGAAGACTAA
GAAGAAAATGATAAATAAACTGGTGTTGCTCATCAAAAAGTAATTAAACCAAAATTAATA
TTTTTATTTAACTTGTTAAAAAAAAATAAATAGATTTATTTGAGCGAAAATTTCGACGTT
ACTCAATCTCCATATTTTGGATTTGACCCTGTTGTTCGTACTCTTTTCATTAAGACTATT
CCTAAAGAACTTGGACGTTAAGATATTTATGAAATTATTTAAAAAATTCCTGGCTTCTAA
AGTTTATCTCTTTCTGAACCAGTTCCTAATCAATAATTCTAAAGGTATCATAATATTTTT
TTTGTAAAAAATTAACCAATTATCCTATGTTTAGATATGGTTGGATTACATTTGAAACAG
AAGAGTAATGCAATTATGCAGCAGAAAGATTTAAAAGCGACTGTCTTGTTATTAACAAAT
ATGAATTTAATATTGTAAAAAATAATCAAAAAAGAATGATAAAAGTAGCTTAAAAAGTCG
ATCTTAAGAAATCTCAAACTGATTTTGAATAAATCATCAAACTTATTGCCAAGTTTGACT
AGTCAAAAACCATTACTGGTAATCCTTTAGTAGAGTTTAGCCCAGAAAATTTCTCTTTCA
AAAATCTCGATATTTGTCTTCTTTACTTACGTCGCATTCATTCTTATTGCTACTATAGTG
GAGTTCACGTAATTTAATTTAGTTTTTCTTATTTTCACATTTTATTAAAACTAGTGCAAC
GATGAGAGAATGCTTACAAGCAAGTGCGGATCTGTTCACTTAAGACTTAAGTCTGATAAC
CCCAATGAAGAATGGGAATTACCTAATTGGTAAAATAAAGTACAAGATCTTGCTAATTAA
AAAATTATAGAATTAGAACAAATAAAGGATTAACTTAAGGGTGTTGCTTTATTCAAGGAG
AGATTAGCTTCCAAAATAACTTACAAGGTACAAAAATAAATGAAGAGCGAGAATGGAGCT
TGGCCATGTTTCTATTGCTCCAAAAAATTCAAAGGCTCAGAATTCGTTGTTAAACACATT
GATAATAAACACTCAAATGAAGAAAAGTATTAATAAGAACTCAATAAGGTAAATAAATAT
TATTTTTACAATTTTTTAAACAGCCTAAATATTTAAAATTTAAACATTATTAGATAAGAT
CTGCAACAACTTTGGAATTGTATTCTAATGATAAAAATAAAATTACTCATTAAGCACCTT
AAAGCAAGGATGGTTAACATTTCCAAAACTTCATGAACAGAAACAAAAAATTTAATGGAG
GTTTTAATAAAGATAAAAAATACAATCAAAAAAGAAATTTTAACAACAACCATTAATTTA
AAGATCTTGATGAACCTGAAATTGGAAACGAAACTCAAATTTCAAATAACACTGCAGGAG
CTATTAATTATTTAGAAATTTGA