Identifiers and Description

Gene Model Identifier

TTHERM_01018340

Standard Name

None

Aliases

PreTt27752 | 199.m00045

Description

Mitochondrial carrier protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00153 ) Mitochondrial carrier protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 26.3%

TetraMine Data

TTHERM_01018340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01130.19.997093137033517e-262mitochondrial carrier protein
(312 aa)
OxytrichaContig13637.0.1.g282.998990600740728e-62Mitochondrial carrier protein
DictyBaseDDB_G02909139.996696112986116e-50mcfS on chromosome: 5 position
4740703 to 4741678
WormBaseWBGene000009964.000820122464668e-47locus:dif-1 Protein dif-1
status:Confirmed UniProt:Q27
257 protein_id:CCD70447.1
SGDYPR058W5.998312950603665e-35YMC1 Mitochondrial protein, pu
tative inner membrane transpor
ter with a role in oleate meta
bolism and glutamate biosynthe
sis; member of the mitochondri
al carrier (MCF) family; has s
imilarity with Ymc2p
Stentor CoeruleusSteCoe_354634.248354255291589e-18

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01018340(coding)
ATGTTCACACAAATTGAAAATACAAAAATAATATTTATTTATTTATTGTTTGAATTGATA
ATTTTGTGTTTTAACAATTAATAAAAATATAAAAAAAGAAAGAAAGATACATATTTAGTA
TAACTTAGGATACTTTTTGCATGTGAAAAGTCTTAAAAATAGTAAATGGATATCACTATC
TCAAAACGATAGAACCAATTATTTATTTGTGACGGGGAAGTGGTATTTATCGATTATTAA
TTATTATCTCAATTTAATCTTTAGTAATTTATCAAAAAAAAAAAAAAAGTAAAAAAGCAT
AAGTAGAAATATACAAAAATGTCTTCAGAAGTTAGCAATAACAATTAGCAAGCTCAAATT
AAGAAGCCACAAGATGACCATTTCAAGGCAATCCTTAAAGATTTAACAGCAGGTTCTATC
GCAGGACTTGCAATTTGCTTGACTGGTCATCCATTTGATACTTTAAAGGTACGTTTGTAG
ATGGGTAATGGTGAGTCACTTTTAAAATGCATCAAAGAAATGTACGTAAAAGAGGGTGTT
CTATCTTATTTCAAGGGTATGGAATCTCCTCTTGTCACTGTACCTCTAGTTAATGCTATT
GTCTTCGGAGCTTATGAATTATACAAAAAAATCACTCACACAGAAAATTAAGAAAGATTC
ACATTTTTTGGAGGACTTTGTGCAGGAATGTTTGCAGGTTTTGTTAACTGCATTGTTATT
GGACCAATCGAACTCGCAAAATGCAGATTATAAATGTAGAAAGAAACAATTCTCTACAAA
GGTCCCTTTGATTGCTTTGCTTAAATTTATAGAAATGAAGGTATAAAAGGTATTTACAGA
GGTATGGTAGCAACCTAATTTAGAGAAATTCCAGCATACGGCGCTCAATTTGCTAGTTAT
GAACTTTATAAAAGCTCTGTTATGAAATACATTAACCATGGCAAAGACCTCTCTCACCTT
TAAACATTAATAGGAGGTGGATTCGGAGGTATCATGTGCTGGGTCTTTTCCTACCCCTAA
GATATTATTAAAACTAAGCTTTAATGCGAAACTGGTCCCATCAAAGGAATGGATGGTGGT
TTTTTTAAAGTTGGCAGATAAATAATAAGAGAAGATGGCGTTAAAGGATTGTGGAAAGGT
TTTAGTGCCTGTCTCACAAGAGCATTTTACGCCAACAGTATAGGTTTTGTTGCTTACGAA
TACTCTAAAAAAATGTTATAAGATGATTTACATGTTGCTGAAGTTGCACATTCCCATTGA


>TTHERM_01018340(protein)
MFTQIENTKIIFIYLLFELIILCFNNQQKYKKRKKDTYLVQLRILFACEKSQKQQMDITI
SKRQNQLFICDGEVVFIDYQLLSQFNLQQFIKKKKKVKKHKQKYTKMSSEVSNNNQQAQI
KKPQDDHFKAILKDLTAGSIAGLAICLTGHPFDTLKVRLQMGNGESLLKCIKEMYVKEGV
LSYFKGMESPLVTVPLVNAIVFGAYELYKKITHTENQERFTFFGGLCAGMFAGFVNCIVI
GPIELAKCRLQMQKETILYKGPFDCFAQIYRNEGIKGIYRGMVATQFREIPAYGAQFASY
ELYKSSVMKYINHGKDLSHLQTLIGGGFGGIMCWVFSYPQDIIKTKLQCETGPIKGMDGG
FFKVGRQIIREDGVKGLWKGFSACLTRAFYANSIGFVAYEYSKKMLQDDLHVAEVAHSH


>TTHERM_01018340(gene)
ATGTTCACACAAATTGAAAATACAAAAATAATATTTATTTATTTATTGTTTGAATTGATA
ATTTTGTGTTTTAACAATTAATAAAAATATAAAAAAAGAAAGAAAGATACATATTTAGTA
TAACTTAGGATACTTTTTGCATGTGAAAAGTCTTAAAAATAGTAAATGGATATCACTATC
TCAAAACGATAGAACCAATTATTTATTTGTGACGGGGAAGTGGTATTTATCGATTATTAA
TTATTATCTCAATTTAATCTTTAGTAATTTATCAAAAAAAAAAAAAAAGTAAAAAAGCAT
AAGTAGAAATATACAAAAATGTCTTCAGAAGTTAGCAATAACAATTAGCAAGCTCAAATT
AAGAAGCCACAAGATGACCATTTCAAGGCAATCCTTAAAGATTTAACAGCAGGTTCTATC
GCAGGACTTGCAATTTGCTTGACTGGTCATCCATTTGATACTTTAAAGGTACGTTTGTAG
ATGGGTAATGGTGAGTCACTTTTAAAATGCATCAAAGAAATGTACGTAAAAGAGGGTGTT
CTATCTTATTTCAAGGGTATGGAATCTCCTCTTGTCACTGTACCTCTAGTTAATGCTATT
GTCTTCGGAGCTTATGAATTATACAAAAAAATCACTCACACAGAAAATTAAGAAAGATTC
ACATTTTTTGGAGGACTTTGTGCAGGAATGTTTGCAGGTTTTGTTAACTGCATTGTTATT
GGACCAATCGAACTCGCAAAATGCAGATTATAAATGTAGAAAGAAACAGTAATTCATATT
CCAATTCGTTTTTTTTTAGAGATTGATTAATATTTTCGATTTTTTGATATTTCATTTTTA
TTGTGCCATAGCCAAAAAGTGTAAAATTCTTTTGCAAGAAATAAAAAATAAGATTTTAAA
AGATTTAAAAGTTAAGCTTTTTTTTTCCTTACAAGAAAATGAAATTTGTTACTGAAATTT
ATCAAAATCAATAAGCTAGATTTTATGTCTGCATTTTACTTAATTTTTACCTTACTGTGC
ACAAAAAAATACTTTGAAAATAGCATTTAAAGCAAGTAAAAAGTAGATCATTTGAGGAAT
TAAATATTTTAGCGAAAATTTATAAATGATTTTTATTTATTTCGACTTTTGCTAAGGATA
AAAAAAGAAAATGTTGCTCATTTTAAAATTTCGAAAAAGGTAGATTGAAAATTTTGAAAT
ACTTTATGAAGAAATATCAATGAAAAGTAGCTAATTTTAAATGATCTAAATTATGTTTAC
TAGATCTTAACTATTTTGAATAAGCCAAAAATTTAAGAATTTAAAACTTAAGTAATTGAA
TAATAAAACTAGAACATAAATTAATTAATTACTTTATGACGTATTTATACATTTATATGA
CAAATTATTCTTATCACAATATTTAAATAAAAATAGATTCTCTACAAAGGTCCCTTTGAT
TGCTTTGCTTAAATTTATAGAAATGAAGGTATAAAAGGTATTTACAGAGGTATGGTAGCA
ACCTAATTTAGAGAAATTCCAGCATACGGCGCTCAATTTGCTAGTTATGAACTTTATAAA
AGCTCTGTTATGAAATACATTAACCATGGCAAAGACCTCTCTCACCTTTAAACATTAATA
GGAGGTGGATTCGGAGGTATCATGTGCTGGGTCTTTTCCTACCCCTAAGATATTATTAAA
ACTAAGCTTTAATGCGAAACTGGTCCCATCAAAGGAATGGATGGTGGTTTTTTTAAAGTT
GGCAGATAAATAATAAGAGAAGATGGCGTTAAAGGATTGTGGAAAGGTTTTAGTGCCTGT
CTCACAAGAGCATTTTACGCCAACAGTATAGGTTTTGTTGCTTACGAATACTCTAAAAAA
ATGTTATAAGATGATTTACATGTTGCTGAAGTTGCACATTCCCATTGA