Identifiers and Description

Gene Model Identifier

TTHERM_01016020

Standard Name

None

Aliases

PreTt02636 | 198.m00056 | 3746.m00320

Description

cyclin-dependent kinase-like Serine/Threonine kinase family protein; Protein kinase domain containing protein. Sequence similarity to the GSK protein kinase family (Eisen et al.- 2006).

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01016020

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20180.19.997093137033517e-262protein kinase domain-containi
ng protein (305 aa)
OxytrichaContig21661.0.g952.000043494209831e-96Protein kinase domain
DictyBaseDDB_G02702189.9952060159684e-60glkA on chromosome: 1 position
4429657 to 4431380
WormBaseWBGene000017469.002663577881587e-59locus:gsk-3 Glycogen synthas
e kinase-3 status:Confirmed
UniProt:Q9U2Q9 protein_id:
CAA22311.1
SGDYGR040W1.999385218781115e-51KSS1 Mitogen-activated protein
kinase (MAPK) involved in sig
nal transduction pathways that
control filamentous growth an
d pheromone response; the KSS1
gene is nonfunctional in S288
C strains and functional in W3
03 strains
Stentor CoeruleusSteCoe_153371.3336148155022614e-34

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_01016020(coding)
ATGATTCCTTTACCCAATTATGAAATAAAAAGAGTTATAGGTTCAGGTTCTTTTGGATAT
GTATTTGAAGCATATGATAACAACAACCAAAGGACTGTTGCTCTAAAGCGTATTTAGAAA
GTTGGCAAAAAGCTAAGTAGAGAATACGAAATTCTTTTAGACATTAAGGACTGCGATTAT
GTAGTGAAAATGATTGATTTGTATTATTCTAAAACAGATGATAATAAGCTAATCCAAAAT
ATTGTTTTTGAATATATGGAAAATAATTTGGAAGATCACATTTCTAAATTCAATAAAAGC
AAAAAAGTAATACCAGAGCAGACTGTAAAAGAATATGCCTACCAAATACTTAAAGGTCTG
TAATATATTCACTCAAAAGGCATTGCTCATCGTGACTTAAAACCAGATAATATACTTTTG
AATGATGACGGCAAAGTGAAAATATGCGATTTTGGTGGTTCTAAGTATATAGATGAAAAA
GGAAAAAATACTCCCTATATAGTTTCTCGTTATTATAGAGCTCCTGAATTGATTCTTTGT
ATAACAAAATATAATTAGAAAATTGATATGTGGTCTTTTGGGTGCATTTTAGGAGAACTT
GTCACTACATTCCCTTTGTTCCAAGGTAAAACTGAAGGAGATTAGCTTTTCTCTATATTC
AAGGTTCTAGGATCTCCCACTAAGGAAGAATTTTAAAAATTCTCTGAAAGAGTACCATTT
GATAAGAAAATATTTGATGAATTTTAGACATACGAACCTTAAAATCTTAGAAAAATGTTC
TTTTACATAAAGGATATTGACAACTTAATGGATTTAATAACTAAGTGTTTACAATATCTT
CCCGAAAATAGAATAACTGCTGACGAAGCATTATAACATCCTTTTTTTAAGGGTCTTGAA
GAAAAGTATCCATGA


>TTHERM_01016020(protein)
MIPLPNYEIKRVIGSGSFGYVFEAYDNNNQRTVALKRIQKVGKKLSREYEILLDIKDCDY
VVKMIDLYYSKTDDNKLIQNIVFEYMENNLEDHISKFNKSKKVIPEQTVKEYAYQILKGL
QYIHSKGIAHRDLKPDNILLNDDGKVKICDFGGSKYIDEKGKNTPYIVSRYYRAPELILC
ITKYNQKIDMWSFGCILGELVTTFPLFQGKTEGDQLFSIFKVLGSPTKEEFQKFSERVPF
DKKIFDEFQTYEPQNLRKMFFYIKDIDNLMDLITKCLQYLPENRITADEALQHPFFKGLE
EKYP


>TTHERM_01016020(gene)
ATGATTCCTTTACCCAATTATGAAATAAAAAGAGTTATAGGTTCAGGTTCTTTTGGTAAT
AAATATTTTAAAGCTGTAGCAAGCATCATTAATGTTTGTATTTATTTACAATTTTAAAAA
TTTCATTATGCTTCTTTATATAATTATTATCATTATCAAACCTTGCTACTTAATGAGTAT
TATGATAAAGAAACAATAAATAAATTAACAAACTTATTCATTAAAATTATGTTTATAGGA
TATGTATTTGAAGCATATGATAACAACAACCAAAGGACTGTTGCTCTAAAGCGTATTTAG
AAAGTTGGCAAAAAGCTAAGTAGAGAATACGAAATTCTTTTAGACATTAAGGACTGCGAT
TATGTAGTGAAAATGATTGTAAAATAGATTTGAATTAATTTATTTATGCTTAAAATAGAC
AGTTTTGGTTGAAATATCATACATACTTAAATATTTTATTTTTATAAAAGGATTTGTATT
ATTCTAAAACAGATGATAATAAGCTAATCCAAAATATTGTTTTTGAATATATGGAAAATA
ATTTGGAAGATCACATTTCTAAATTCAATAAAAGCAAAAAAGTAATACCAGAGCAGACTG
TAAAAGTATGAAGTTTATTAAATTTGAATTGTTGAATGAAATAGTGAATTATAATTAAAT
CAATAGGAATATGCCTACCAAATACTTAAAGGTCTGTAATATATTCACTCAAAAGGCATT
GCTCATCGTGACTTAAAACCGTAAGAACATTTATTTATTTATACCTTTTAAGTGATGCTT
TTAATATATAAAATATAGAGATAATATACTTTTGAATGATGACGGCAAAGTGAAAATATG
CGATTTTGGTATATTAAATTTATAAAATAAATAGACATTAAAAAATTGTTTTAATGATTA
AAGGTGGTTCTAAGTATATAGATGAAAAAGGAAAAAATACTCCCTATATAGTTTCTCGTT
ATTATAGAGCTCCTGAATTGATTCTTTGTATAACAAAATATAATTAGAAAATTGATATGT
GGTGTAATTAAATAAATTCATTAGCATTATAATTGATTTTTACTTATTTTTCTTTTAAAA
AGCTTTTGGGTGCATTTTAGGAGAACTTGTCACTACATTCCCTTTGTTCCAAGGTAAAAC
TGAAGGAGATTAGCTTTTCTCTATATTCAAGGTTCTAGGATCTCCCACTAAGGAAGAATT
TTAAAAATTCTCTGAAAGAGTACCATTTGATAAGAAAATATTTGATGAATTTTAGACATA
CGAACCTTAAAATCTTAGAAAAATGTTCTTTTACATAAAGGATATTGACAACTTAATGGA
TTTAATAACTAAGTGTTTACAATATCTTCCCGAAAATAGAATAACTGCTGACGAAGCATT
ATAACATCCTTTTTTTAAGGGTCTTGAAGAAAAGTATCCATGA