Identifiers and Description

Gene Model Identifier

TTHERM_01005330

Standard Name

None

Aliases

PreTt27650 | 192.m00088 | 3757.m00336

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_01005330

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19910.12.0009356157506544e-160hypothetical protein (290 aa)
DictyBaseDDB_G02885431.0002869940498747e-21pop4 on chromosome: 5 position
1668067 to 1669008
WormBaseWBGene000076039.99946582325553e-18status:Confirmed UniProt:Q9X
VT1 protein_id:CAB02730.1
OxytrichaContig10061.0.g521.000361553249356e-16Domain of unknown function UPF
0086
SGDYBR257W0.00000000019994075865167896POP4 Subunit of both RNase MRP
and nuclear RNase P; RNase MR
P cleaves pre-rRNA, while nucl
ear RNase P cleaves tRNA precu
rsors to generate mature 5 end
s and facilitates turnover of
nuclear RNAs; binds to the RPR
1 RNA subunit in RNase P

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01005330(coding)
ATGGGAGATATTGATGACCTATTTGCTCAGTTAGGGAGCAAACCAAAGTAGCCATAATAA
AAATAGTAAAAAGCATAAATATTACCTGAAAAGCCTTAATAAAATGTACAAAAAAAGACA
GCTAATTAGCAATAACAATCTGCAAAGTAGCCTTCATAAAATTAATAAATAGATGTAAAG
AAAACTGAAACAATAGTAGTCGAATAACCAACTCTTTTCAAGCTGGACAAGAATAATATA
TATGGAAAACTAGATGCGAAAGAATATGCTACCTTATAAAATGGATCTGAAATTATAGAA
GAGATAGTGTCAGATGGATTTAAGTTTAAAAATAAAATAGATAACAAGGCATTTTTAATA
GAAAAATTTTAGCAGCAATTAAACATGAAAAATAAATATAAAAAAGAGGAATTTAATTCT
GATATATGTAAAAAGGCTTTGAAATAAGTAGGATATTTTGGTATTCCAAAGACAAACTTA
AAATATGCTACTTTTTTACCTATGAATAACATGTGGAAAACATACATAAGACAATTAATT
TCTAATGACTTAAAAGATGAAAACGGATATGCTAAATTTTTAAAAGCAGACTTACATGGC
TCTATTATACAAATATTAACTAGCAAGTGCTAATCTTATGAAGGTATGCAAGGGATAGTC
TTGTAAGAAAAGCTAAAGAGCTTTAGAGTGATTACTTAGGAGGATAAAATAATAACTGTT
ATTAAATAAAATTCTGTGTTTTTATTTGAAGTGTATCCTTAAAGAATATTCAAAGTTTAT
GGTTGCCATCTGATGATTAGACCTTCTGATAGGATAAAGTAAAAATTTAAAATGAGAGCT
GCATCATAATTTGTTTTAGATAACAGTTGA


>TTHERM_01005330(protein)
MGDIDDLFAQLGSKPKQPQQKQQKAQILPEKPQQNVQKKTANQQQQSAKQPSQNQQIDVK
KTETIVVEQPTLFKLDKNNIYGKLDAKEYATLQNGSEIIEEIVSDGFKFKNKIDNKAFLI
EKFQQQLNMKNKYKKEEFNSDICKKALKQVGYFGIPKTNLKYATFLPMNNMWKTYIRQLI
SNDLKDENGYAKFLKADLHGSIIQILTSKCQSYEGMQGIVLQEKLKSFRVITQEDKIITV
IKQNSVFLFEVYPQRIFKVYGCHLMIRPSDRIKQKFKMRAASQFVLDNS


>TTHERM_01005330(gene)
ATGGGAGATATTGATGACCTATTTGCTCAGTTAGGGAGCAAACCAAAGTAGCCATAATAA
AAATAGTAAAAAGCATAAATATTACCTGAAAAGCCTTAATAAAATGTACAAAAAAAGACA
GCTAATTAGCAATAACAATCTGCAAAGTAGCCTTCATAAAATTAATAAATAGATGTAAAG
AAAACTGAAACAATAGTAGTCGAATAACCAACTCTTTTCAAGCTGGACAAGAATAATATA
TATGGAAAACTAGATGCGAAAGAATATGCTACCTTATAAAATGTACATAAAAAATTATAT
TTTACAGTATGTTGATGGGTAGTTTAAGATCTAATTTTTATTTCATTAAAGGGATCTGAA
ATTATAGAAGAGATAGTGTCAGATGGATTTAAGTTTAAAAATAAAATAGATAACAAGGCA
TTTTTAATAGAAAAATTTTAGCAGCAATTAAACATGAAAAATAAATATAAAAAAGAGGAA
TTTAGTAAGTTTTTAAATCTTTTTTGAAAAGAAGCATTTTCATGCTTAATTTAACCTATT
AATTAATATTGTATAGATTCTGATATATGTAAAAAGGCTTTGAAATAAGTAGGATATTTT
GGTATTCCAAAGACAAACTTAAAATATGCTACTTTTTTACCTATGAATAACATGTGGAAA
ACATACATAAGACAATTAATTTCTAATGAGTAAATATTATTTTCTACTTTAATATTTTAG
TAAAATGTTTAATTTATTTTAGCTTAAAAGATGAAAACGGATATGCTAAATTTTTAAAAG
CAGACTTACATGGCTCTATTATACAAAGTAAATAATTAAATAGTCATTTTTCATTTTTCA
TTAAATATCCTTTAAAGTATTAACTAGCAAGTGCTAATCTTATGAAGGTATGCAAGGGAT
AGTCTTGTAAGAAAAGCTAAAGAGCTTTAGAGTGATTACTTAGGAGGATAAAATAATAAG
TAAAATTAATTATTATTTATTTAATATTGGCTTTAATAATTTTTCATTTTTAAAAGCTGT
TATTAAATAAAATTCTGTGTTTTTATTTGAAGTGTATCCTTAAAGAATATTCAAAGTTTA
TGGTTGCCATCTGATGATTAGAGTAAATTCGTTTGTTTAAATGTTTTAATAATTGAAATA
AATTATAAATAAATAATAGCCTTCTGATAGGATAAAGTAAAAATTTAAAATGAGAGCTGC
ATCATAATTTGTTTTAGATAACAGTTGA