Identifiers and Description

Gene Model Identifier

TTHERM_01005150

Standard Name

AMT6 (Adenine MethylTransferase (AMT) 6 )

Aliases

PreTt27632 | 192.m00070 | 3757.m00318

Description

MT-A70 family protein, methyltransferase MT putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.3%

TetraMine Data

TTHERM_01005150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19889.19.997093137033517e-262hypothetical protein (326 aa)
OxytrichaContig1237.1.g1261.9996410647472548e-29MT-A70

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31722409: Wang Y, Sheng Y, Liu Y, Zhang W, Cheng T, Duan L, Pan B, Qiao Y, Liu Y, Gao S (2019) A distinct class of eukaryotic MT-A70 methyltransferases maintain symmetric DNA N6-adenine methylation at the ApT dinucleotides as an epigenetic mark associated with transcription. Nucleic acids research 47(22):11771-11789

Sequences

>TTHERM_01005150(coding)
ATGTCTCAAGAAACTTTAGCTGCCTGCCAATCTCTCGACAAATTCGCTCATCCAAAGAAG
GTTTCACCTGTTTAGAAGTCCCAGATTATTGAAGAGCCTCCTTTATAAAAGAAGATAAAG
CCAACTGAACCAGGTGAAGATTAACTAAGTCTACTTTTGAAATGGAGAAGCTCATACATC
CCTCCTCAAAAACCCACCAACGAAGATGAATATAAGAAAATTATATGTAAGGATATATCA
AGCGAAAAACTTGAATAGCATGCAGGAGATGTTTCTGCTTTATTTATTAATATAAAATGG
AAGTTATCTGAAGGATAAAGTGGCAAGTCAATAGAAGATTTAAAAAAATTAGCAATTAGC
GATAAGCTGATTAACAATGGCATCATATTTATTTGGAGCGAAAAGGAAATATTAAGTTAA
ATTGTTGACGTCCTTGAAGCAAAAGGATTCAATTATATAGAAAATTTCATGATTAACTAG
CTTTCAGCAGACAAAGCTCTAGAAATGTAAAGAAAAAATTAAAATTAGTAAAGTAAAGAG
AAAAAAATTACAGATTTCTTTAAGAGATTAACACCTCAAAAGAATATTTGGTCTGATATA
ACTCCAGAACAGTGTATTGAATAAGAAAAGTTCCCTCCAAATAACTATGTCTAAGATATT
TTTGTAAATAGTGAATACAGTTTTTTCAGAAAATCAAAAAAAATCCTTTTAATGCTTCGT
AAATTCAATAAAGATGCTTAACTTGAATTAAGACATTAGCGTACTTCTGACATATTCTTT
GATATTTTTGAATAAAACAAGCCAAATGATGTAAGCAAAAAAGGAATGGAATTTGTTTAT
AAAATGATAGAAACCCTCCTTCCCAAAGCTAATTATAGCGAAGAAAATAAAGGAGCTTTT
AAAATGATGGAATTGTATGCTGATGATAAGTCTTAACCTAGAAAGGGATGGATAAGCGTA
TATGAATAAGAGTGA


>TTHERM_01005150(protein)
MSQETLAACQSLDKFAHPKKVSPVQKSQIIEEPPLQKKIKPTEPGEDQLSLLLKWRSSYI
PPQKPTNEDEYKKIICKDISSEKLEQHAGDVSALFINIKWKLSEGQSGKSIEDLKKLAIS
DKLINNGIIFIWSEKEILSQIVDVLEAKGFNYIENFMINQLSADKALEMQRKNQNQQSKE
KKITDFFKRLTPQKNIWSDITPEQCIEQEKFPPNNYVQDIFVNSEYSFFRKSKKILLMLR
KFNKDAQLELRHQRTSDIFFDIFEQNKPNDVSKKGMEFVYKMIETLLPKANYSEENKGAF
KMMELYADDKSQPRKGWISVYEQE


>TTHERM_01005150(gene)
ATGGTAAGATCTTTTAATTTCATTAATATAATTATTAAATTAAGAAAATTTTAATTATAT
TACATGATGAAGTCTCAAGAAACTTTAGCTGCCTGCCAATCTCTCGACAAGTAATTATAG
CCACAAAAGCTTAAAATTTTATAAAAATAAGCATATAGTAAAATGTATTCTATTATAATT
AAACTAGATTCGCTCATCCAAAGAAGGTTTCACCTGTTTAGGTAATAGCATATATCCATT
TTATTAAAATTTTAGTCCTTAAAAAGAATATATCAAAATATTCTATCACAAAAAATGTAG
AAGTCCCAGATTATTGAAGAGCCTCCTTTATAAAAGAAGATAAAGCCAACTGAACCAGGG
TAAATCATTTTAGAATTATCATTTAATTTCTTATCTTTATCAGTTTAAGATGCTACCTTA
CCAAGCTCTACTTATAGATTAGATACTTATCATTCTATGAGAAGATTTTAACCCTCTTAG
GAGGAAAAAATTTTAACTTTAAACTTTTTAAAAATTTAGTGAAGATTAACTAAGTCTACT
TTTGAAATGGAGAAGCTCATACATCCCTCCTCAAAAACCCACCAACGAAGATGAATATAA
GTAAGCTTTTTTGATTTTAAAATAAAAAGAACTCAACTAAATTAAGAAATGAAGCTCTAA
AATTAGCAAAAAATCATATTTGATTTCCAGAAAAGAGTAATTAATTTATCAAAATTAAAA
TTAGGAAAATTATATGTAAGGATATATCAAGCGAAAAACTTGAATAGCATGCAGGAGATG
TTTCTGCTTTATTTATTAATATAAAATGGAAGTTATCTGAAGGATAAAGTGGCAAGTCAA
TAGAAGATTTAGTAAAAATAAATTTCATATTCGATAGTTATTGCTGATTTCTACCATTTT
ATTTACATTTTTTTCTTAATATAGAAAAAATTAGCAATTAGCGATAAGCTGATTAACAAT
GGCATCATATTTATTTGGAGCGAAAAGGAAATATTAAGTTAAATTGTTGACGTCCTTGAA
GCAAAAGGATTCAATTATATAGAAAATTTCATGATTAACTAGCTTTCAGCAGACAAAGCT
CTAGAAATGTAAAGAAAAAATTAAAATTAGTAAAGTAAAGAGAAAAAAATTACAGATTTC
TTTAAGAGATTAACACCTCAAAAGAATATTTGGTCTGATATAACTCCAGAACAGTGTATT
GAATAAGAAAAGTTCCCTCCAAATAACTATGTCTAAGATATTTTTGTAAATAGTGAATAC
AGTTTTTTCAGAAAATCAAAAAAAATCCTTTTAATGCTTCGTAAATTCAATAAAGATGCT
TAACTTGAATTAAGACATTAGCGTACTTCTGACATATTCTTTGATATTTTTGAATAAAAC
AAGCCAAATGGTAATTAATTATAAATCTTAACTTAAGTTAAATTTTTCTAAAAATTTTTT
TATTCTTTTAAAAAGATGTAAGCAAAAAAGGAATGGAATTTGTTTATAAAATGATAGAAA
CCCTCCTTCCCAAAGCTAATTATAGCGAAGAAAATAAAGGAGCTTTTAAAATGATGGAAT
TGTATGCTGATGATAAGTCTTAACCTAGAAAGGGATGGATAAGCGTATATGAATAAGAGT
GA